KEGG   Shewanella baltica OS195: Sbal195_2631Help
Entry
Sbal195_2631      CDS       T00622                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00020  Citrate cycle (TCA cycle)
sbn00190  Oxidative phosphorylation
sbn00650  Butanoate metabolism
sbn01100  Metabolic pathways
sbn01110  Biosynthesis of secondary metabolites
sbn01120  Microbial metabolism in diverse environments
sbn01130  Biosynthesis of antibiotics
sbn01200  Carbon metabolism
Module
sbn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal195_2631
   00650 Butanoate metabolism
    Sbal195_2631
  Energy metabolism
   00190 Oxidative phosphorylation
    Sbal195_2631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABX49799
UniProt: A9L537
Position
complement(3117863..3118210)
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDYILLRASAVILACYTIFLVGFIACSSPLTYDVWHSLFSALPMKVF
TLLALVALLVHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgcagcaagttttggacgcagtggtgttcatgactatattctactacgc
gctagtgcagtgatcctcgcctgttacaccattttcttggttggctttattgcatgtagt
tcccctctcacctacgacgtctggcatagcctttttagcgctctgccgatgaaagtgttt
acacttctggcgctggtagcattattagtacacgcttggattggtgtatggcaagtgctg
acagattacgtcaagtgcacgtcgttacgtggtgttttacagttcacctttgtcgttacc
gtattttgttatttagcggccggcattgttattgtgtggggtgtctaa

DBGET integrated database retrieval system