KEGG   Shewanella baltica OS195: Sbal195_2648Help
Entry
Sbal195_2648      CDS       T00622                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sbn  Shewanella baltica OS195
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3138187..3139221
Genome map
AA seq 344 aa AA seqDB search
MTKLTSIAIFIAGIFASAHAISAEPIEVIKAVKVTEPEKVELGKMLFFEPRLSKSGYISC
NSCHNLATGGVDALPTSVGHNWQQGPINSPTVLNANYMLAQFWDGRASDLQAQAAGPIEN
PKEMGYSHALATQTIASMPAYRAHFAKVYGDENVTIDRLTDAISTFEKTLVTPNSPFDQY
LLGKQDAISVDAKAGYQLFKSKGCVSCHNGPAVGGTMYMKMGLIKPFHTNNPAEGRIAVT
GKEADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLSDKENLEMVAFL
VSLTGDQPQITLPILPPSNKNTPRPVPFSHDPMSSKPVSSEPLK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactcacatctattgctattttcattgcgggtattttcgccagtgcccatgcc
atcagtgctgaacccatcgaagtgataaaagcggtgaaagttaccgaaccggagaaagtt
gaactcggtaaaatgctgttcttcgaaccaaggctatccaaatcgggctacatctcctgt
aactcttgccacaatttagccactggcggagtcgatgcactaccaacctctgttggccat
aattggcaacaaggcccgattaactcgcccacagtgctcaatgccaattatatgctggcg
caattttgggatggccgcgccagtgatttacaagcgcaagccgctggccctatcgagaat
cctaaggaaatgggctatagccatgcactcgcgacacaaactattgcctctatgcctgcc
tatcgggcgcattttgccaaagtctatggcgatgaaaacgtcacgattgatcgcttaacc
gatgcaatttccacctttgaaaaaaccttagtcacgccaaatagtccgttcgatcaatat
ttattgggtaagcaagatgcgatcagtgtggatgccaaagcgggttaccaactgtttaag
agcaaagggtgcgtaagctgccataacggtccagccgtcggtggcactatgtatatgaag
atgggattgattaaacctttccacactaataatcccgccgaaggtcgtatcgccgtcaca
ggtaaagaagccgataagtttgtctttaaagtgccgacactgcgcaatattgaactcacc
tatccctacttccacgacggcagtgtctggaccttagaagaagcggtgaacactatggcc
gatattcaattaggccaaaaactgtcggacaaagaaaatctagaaatggtcgcctttctc
gtctcgttgacgggagatcaacctcagatcaccttgccgattttgccgccatccaacaag
aacacaccgcgcccagtgccttttagccatgatccaatgagtagcaagccagttagcagt
gagccattaaagtag

DBGET integrated database retrieval system