KEGG   Shewanella baltica OS195: Sbal195_2785Help
Entry
Sbal195_2785      CDS       T00622                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sbn  Shewanella baltica OS195
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:sbn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3317125..3317682
Genome map
AA seq 185 aa AA seqDB search
MATPAHAAKVLILGDSLGASYGMAEQSGWVALLQKNLPEHQFTNGSVSGETTAGGLRRLP
ALLDSVAPDLVVVELGGNDGLRGFPPTQLENNLIQIITLAKDSGAKVLLTEIMVPPNYGP
RYTQKFTQVYQDISKAQDIVLIPFFMQDIAPHPELMQRDGIHPNEKAQTQIATWMQPWIE
DALTQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggccacgccagcgcacgcggcaaaggtgttgatcctcggcgacagcttaggcgctagc
tatggcatggcagagcagtcaggctgggtggcgctgctgcaaaaaaatctgcccgaacat
caatttactaatggctcagtgagcggcgaaaccacagctggcggcttacgccgattaccc
gccttactcgattccgtcgcccccgaccttgtggtcgttgaactgggtggtaatgatggt
ttacgtggattccccccaacgcaacttgaaaataatctaatccaaatcattaccctagcc
aaagatagcggcgcaaaagtgctgctgaccgagatcatggtaccgcctaactatggccct
cgctacacccaaaagttcacccaagtgtatcaagacatatccaaagcacaggatatcgtg
ttgatccccttctttatgcaggatatcgcgccccatccagaattaatgcaacgggatggc
attcaccccaacgaaaaggcgcagacgcagatagcaacttggatgcaaccatggatagaa
gatgcgttaacccaataa

DBGET integrated database retrieval system