KEGG   Shewanella baltica OS195: Sbal195_2785Help
Entry
Sbal195_2785      CDS       T00622                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sbn  Shewanella baltica OS195
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sbal195_2785
Enzymes [BR:sbn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sbal195_2785
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Sbal195_2785
Lipid biosynthesis proteins [BR:sbn01004]
 Fatty acid synthase
  Component type
   Sbal195_2785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3317125..3317682
Genome map
AA seq 185 aa AA seqDB search
MATPAHAAKVLILGDSLGASYGMAEQSGWVALLQKNLPEHQFTNGSVSGETTAGGLRRLP
ALLDSVAPDLVVVELGGNDGLRGFPPTQLENNLIQIITLAKDSGAKVLLTEIMVPPNYGP
RYTQKFTQVYQDISKAQDIVLIPFFMQDIAPHPELMQRDGIHPNEKAQTQIATWMQPWIE
DALTQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggccacgccagcgcacgcggcaaaggtgttgatcctcggcgacagcttaggcgctagc
tatggcatggcagagcagtcaggctgggtggcgctgctgcaaaaaaatctgcccgaacat
caatttactaatggctcagtgagcggcgaaaccacagctggcggcttacgccgattaccc
gccttactcgattccgtcgcccccgaccttgtggtcgttgaactgggtggtaatgatggt
ttacgtggattccccccaacgcaacttgaaaataatctaatccaaatcattaccctagcc
aaagatagcggcgcaaaagtgctgctgaccgagatcatggtaccgcctaactatggccct
cgctacacccaaaagttcacccaagtgtatcaagacatatccaaagcacaggatatcgtg
ttgatccccttctttatgcaggatatcgcgccccatccagaattaatgcaacgggatggc
attcaccccaacgaaaaggcgcagacgcagatagcaacttggatgcaaccatggatagaa
gatgcgttaacccaataa

DBGET integrated database retrieval system