KEGG   Shewanella baltica OS195: Sbal195_2804Help
Entry
Sbal195_2804      CDS       T00622                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase., Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sbn01100  Metabolic pathways
sbn01110  Biosynthesis of secondary metabolites
sbn01130  Biosynthesis of antibiotics
sbn01230  Biosynthesis of amino acids
Module
sbn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal195_2804
Enzymes [BR:sbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sbal195_2804
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Sbal195_2804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABX49971
UniProt: A9KTR6
Position
3337686..3339173
Genome map
AA seq 495 aa AA seqDB search
MSQVEVTPTAMTQDLRTQPEAATNAMPKSNVLTRIVDTKAAHIAALKLRFPEASLSPKIS
DRSLFAALKAPKAGYILECKKASPSKGLIRDVFDVEAIADIYGKYAAGISVLTDEQFFQG
DMDYIPKVRARVNQPILCKDFFVDEYQIKLAAHQGADAILLMLSVLDDEQYQHLAKEAAK
YQLDVLTEVSNEEELKRAIALDAPIIGINNRNLRDLSTDLATTETLAPHIGSDRVVISES
GIYNNAQVRRLSPLVDGFLVGSSIMAEADIDLACRKLIFGHNKVCGLTRVEDMRAAATAG
AVYGGLIFAEKSPRALTLDAAEQLLRAYRASDAPAIEFVGVFVNAAASTITDIAARLQLS
AVQLHGTETELEIAQLAERLEQAGLTTQIWKAVSVDAQTGELGNLPLGAQRYLFDSKTAG
QFGGSGQAFNWQNIDVKSLGQQKAHAMLAGGLNADNAASANAQGFYGLDFNSGLETAAGI
KSAQLIQTAFTHLRL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagtagaagtgactccaacagcaatgactcaagacctgcgtactcagccagag
gcagccacaaacgctatgccaaaaagtaatgtgttaacccgtattgtcgataccaaagcg
gcccatattgccgccctgaagctgcgtttccctgaggcgagtctgtcgccaaaaatctct
gaccgcagtttatttgccgcactcaaggcacccaaggcgggttacattttagaatgcaaa
aaagccagtccatccaaagggcttatccgcgatgtgtttgatgtagaagccatcgccgat
atttacggtaaatatgcggcgggcatttcggtattaaccgacgagcaatttttccaaggg
gatatggactatatccctaaggtgcgcgctcgggtcaaccaaccgattctatgcaaagat
ttttttgtggacgagtaccaaatcaaactcgctgctcaccaaggcgccgatgcgattctg
ttgatgctgtccgtgcttgatgatgaacaatatcaacatctagcgaaagaagcggctaag
tatcaactcgatgtactgaccgaagtcagtaatgaagaagaacttaagcgcgccatcgca
ttagatgcgccgattattggcatcaacaaccgtaacttaagggatttgagtaccgatctc
gctaccacagagaccttagcgccacacatcggcagcgaccgcgtggtgatcagcgaatct
ggcatctacaacaatgcgcaagtgcgccgcctgagtccgctggtcgatggcttcctcgtt
ggcagctcgattatggccgaggctgatatcgacttagcctgccgtaaattgatcttcggt
cacaataaagtctgcggcctcacccgtgtggaagatatgcgcgccgcggcaacagcaggc
gctgtctatggtgggctgatttttgctgaaaaatccccgcgcgcgttaacccttgatgcc
gcagaacaactgctcagggcgtatcgcgcatccgatgcccccgccattgaatttgtcggc
gtgtttgttaatgccgcggcaagcaccatcaccgatatcgccgcccgtttgcagttatct
gccgtacagctgcacggcacagaaactgaacttgaaatagcacagctcgccgagcgactt
gagcaagcgggactcaccacccaaatttggaaagccgtcagcgtcgatgcgcaaacgggt
gaacttggcaacttgcctctgggagcacagcgttatctgtttgatagtaaaacggcaggc
caatttggcggctcgggccaagcctttaattggcaaaatattgatgtgaagtccttaggc
cagcaaaaggcccatgccatgttggcgggcggactcaacgccgacaatgcggccagtgcc
aatgcccaaggattttacggtttagattttaattctggcctagaaaccgccgcaggaatt
aaatcggcgcaactgatccaaacggcttttacccatttacgtctctag

DBGET integrated database retrieval system