KEGG   Shewanella baltica OS195: Sbal195_2855Help
Entry
Sbal195_2855      CDS       T00622                                 

Definition
(GenBank) fatty acid oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00071  Fatty acid degradation
sbn00280  Valine, leucine and isoleucine degradation
sbn00281  Geraniol degradation
sbn00310  Lysine degradation
sbn00362  Benzoate degradation
sbn00380  Tryptophan metabolism
sbn00410  beta-Alanine metabolism
sbn00640  Propanoate metabolism
sbn00650  Butanoate metabolism
sbn00903  Limonene and pinene degradation
sbn00930  Caprolactam degradation
sbn01040  Biosynthesis of unsaturated fatty acids
sbn01100  Metabolic pathways
sbn01110  Biosynthesis of secondary metabolites
sbn01120  Microbial metabolism in diverse environments
sbn01130  Biosynthesis of antibiotics
sbn01200  Carbon metabolism
sbn01212  Fatty acid metabolism
Module
sbn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sbal195_2855
   00650 Butanoate metabolism
    Sbal195_2855
  Lipid metabolism
   00071 Fatty acid degradation
    Sbal195_2855
   01040 Biosynthesis of unsaturated fatty acids
    Sbal195_2855
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sbal195_2855
   00310 Lysine degradation
    Sbal195_2855
   00380 Tryptophan metabolism
    Sbal195_2855
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sbal195_2855
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sbal195_2855
   00281 Geraniol degradation
    Sbal195_2855
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sbal195_2855
   00930 Caprolactam degradation
    Sbal195_2855
Enzymes [BR:sbn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sbal195_2855
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sbal195_2855
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sbal195_2855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 LEM Gemin6
Motif
Other DBs
NCBI-ProteinID: ABX50021
UniProt: A9KTW6
Position
complement(3401758..3403878)
Genome map
AA seq 706 aa AA seqDB search
MEKTFNLTRRDDGIAILTMDVPGETMNTLKAQFGPEISEILAEIKSDSSIRGLVLISGKK
DSFVAGADISMLDACKTASDAKALSQQGHVVFNELEALTIPVVAAIHGACLGGGLELALA
CHQRVCSDDGKTMLGVPEVQLGLLPGGGGTQRLPRLVGITTALDMMLTGKQIRPKQALKM
GLVNDVVPQTILLQTAVEMVLAGKRAPKPVKKSLVNQVLEGTSFGRNIIFDQATKQVEKK
TQGNYPAPAKIIDCVRQGIAKGMQKGLEVEASHFAELVVSKESEALRSIFFATTEMKKET
GAEGASPRKVKKAVILGGGLMGGGIASVTTTKAKIPVRVKDISEKGLSNALAYAYKLLDK
GVKRRHMTPAARDNLMALMTTTTEYKGVKDADIVVEAVFEDLALKHQMVKDIERECGEHT
IFASNTSSLPISQIAEAATRPENVIGLHYFSPVEKMPLVEVIAHAKTSPETIATTVAFAR
KQGKTPIVVQDGAGFYVNRILALYMNEAAQLLLEGQSVEHLDKALVKFGFPVGPITLLDE
VGIDVGAKISPILEKELGERFKAPAAFDKLLGDDRKGRKNGKGFYQYGASSNKAKAVDES
VYGVLGIKPGTNKDAKAVAERCVVQMLNEAVRCLEDGIIASPRDGDIGAIFGIGFPPFLG
GPFHYIDTLGAANLVRILEGYQSQFGNRFEPCERLKTMAQENAHFF
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagacctttaatttaacccgccgcgacgacggcattgctattttgactatggat
gttcctggcgaaaccatgaacaccctaaaagcgcagtttggccctgaaatcagtgagatt
ctggccgagatcaaaagtgattcgagcattcgcggtttagtgctgatctcaggcaaaaaa
gattcttttgtcgcgggcgcagatatttctatgctcgatgcttgtaaaacggcgagcgat
gccaaagccttatcccagcaaggccatgtggtttttaatgagctagaagccttaactatt
cctgtggttgccgcaatccatggtgcctgtttaggcggtggtttagagttagccttagcc
tgtcatcaaagggtatgtagcgatgatggcaagactatgctcggcgttccggaagtccaa
cttggcttattgccaggcggcggcgggactcaacgtttgccccgtttagtcggcattacc
accgccttagatatgatgctaaccggtaaacaaattcgtcctaagcaagccttgaaaatg
ggcttagtgaatgatgttgtgccgcagacaattttgctacaaaccgcagttgagatggtg
cttgcgggtaaacgtgcaccaaaaccagttaaaaagtcactcgttaatcaagtgcttgaa
ggcacgagtttcggccgtaacattattttcgatcaagcgactaagcaggtcgaaaagaaa
acccaaggtaattatcctgcgcctgccaagatcattgactgtgtgcgtcaaggaattgct
aagggcatgcaaaagggtttagaagtcgaagccagtcattttgccgaattagtggtatcg
aaagaatctgaagcgctgcgcagtattttcttcgcaaccacagaaatgaagaaagaaact
ggcgcagaaggcgcgagcccgcgcaaagtgaaaaaagcggtgatcttaggtggcggttta
atggggggcggtatcgcatctgtcacaacgaccaaggccaaaatccccgttcgcgtcaaa
gacatcagcgaaaaaggtttaagcaatgcattagcttacgcctacaagctgttggataaa
ggggttaagcgccgtcatatgacgcctgctgctcgtgacaacctaatggcactgatgacc
acaacgactgagtataaaggcgttaaagatgccgacatcgttgtggaagcggtatttgaa
gacctagcgcttaagcatcaaatggtgaaagacattgagcgtgagtgtggtgagcacacc
atttttgcgtcaaacacctcatctttgcctattagccaaatcgccgaagcggcaacgcgt
cctgagaacgtgataggtctgcattatttctcgccagtagaaaaaatgccgctggtggaa
gtgattgcccatgctaaaacgtcaccagaaaccattgcgaccacggtcgcatttgcccgt
aagcaaggtaaaacaccgatagtggtgcaagacggcgcgggtttctacgtgaaccgtatt
cttgcgctctacatgaacgaggccgcgcaattattacttgaaggccaaagtgttgaacat
cttgataaagcgctggttaagtttggtttccctgtgggccccattactttactcgacgaa
gtgggtatcgacgtgggcgctaagatttcaccaatcctcgaaaaagaattgggtgaacgt
tttaaagcgccagcggcttttgacaagctattgggtgacgatcgtaaaggccgtaaaaat
ggtaaaggtttctatcaatacggcgcatcgagcaataaagctaaagctgtcgatgagagt
gtttatggcgtgttaggcattaagcctggcaccaataaagacgcaaaagcggttgccgag
cgttgtgtcgtacaaatgctcaacgaagctgtacgttgtttagaagacggtattatcgca
tcgccaagagatggtgatattggcgccattttcggtattggcttcccgccattcctcggt
ggcccattccattatattgacactttgggcgccgcaaacttagtgcgaattcttgaaggt
tatcaaagccaattcggtaacagattcgaaccttgtgagcgcttaaaaaccatggctcaa
gaaaacgcgcactttttctaa

DBGET integrated database retrieval system