KEGG   Shewanella baltica OS195: Sbal195_3421Help
Entry
Sbal195_3421      CDS       T00622                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00010  Glycolysis / Gluconeogenesis
sbn00051  Fructose and mannose metabolism
sbn00562  Inositol phosphate metabolism
sbn01100  Metabolic pathways
sbn01110  Biosynthesis of secondary metabolites
sbn01120  Microbial metabolism in diverse environments
sbn01130  Biosynthesis of antibiotics
sbn01200  Carbon metabolism
sbn01230  Biosynthesis of amino acids
Module
sbn_M00002  Glycolysis, core module involving three-carbon compounds
sbn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal195_3421
   00051 Fructose and mannose metabolism
    Sbal195_3421
   00562 Inositol phosphate metabolism
    Sbal195_3421
Enzymes [BR:sbn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sbal195_3421
Exosome [BR:sbn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sbal195_3421
  Exosomal proteins of bladder cancer cells
   Sbal195_3421
  Exosomal proteins of melanoma cells
   Sbal195_3421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABX50583
UniProt: A9KZX5
Position
complement(4038028..4038810)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSSEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagtgcggcatta
gcccaagagttgttcaaaaaatttgcctctaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagagagcgttaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgcacaaaacctaagtcaacacgactttggc
gcttataccggagaagtttcaggtcagatgctcaaagattcaggatgtcgatatgtgatt
atcggacattcagaacgtcgccgtatgtacggagagacgagtaatatcgtagcggagaaa
ttcgccgctgcacaaaagcatggcttaactcccattttatgtgtgggtgagtcaggtcca
gcacgtgaagcaagacgcacctttgaggtgattgcggaagagttggatatagtgatccag
aaaaacggcactatggcttttgataacgccattatcgcctacgagccactttgggctgta
gggacaggtaaaagcgctacaccagagcaggcacaagaagttcatgcgtttattcgcaaa
cgcctctctgaagtgtctccgtttatcggagaaaatatcaggattctctacggtggtagt
gtaacaccgagtaatgctgcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgctagcttaaactctagcgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system