KEGG   Shewanella baltica OS195: Sbal195_3740Help
Entry
Sbal195_3740      CDS       T00622                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sbn  Shewanella baltica OS195
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sbn00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4406611..4407465
Genome map
AA seq 284 aa AA seqDB search
MPAAISRNWPAPAKLNLFLHINGRRADGYHELQTLFQFIDYCDMLDFKVTETPELILHSN
MSGVVADSDNLILRAAKSLQQTTGFNGGAEIWLDKRLPMGGGLGGGSSDAATTLVALNTL
WHTQLSTEELAKIGLKLGADIPVFIHGFAAFAEGVGERLQAVNPSEPWYLVIAPDAHVST
ADVFQDPLLPRDTPKLAIDTLMSQPWANDCQKLVVSKYPQVAKALGWLLEYAPSRMTGTG
ACVFGEFTQQQQALAALAKLPSEMQGFVAQGMNLSPLITRLSHP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctgcaatttcccgcaattggcctgcgccagccaagctcaacttgtttttacac
attaatggccgccgcgccgacggttaccacgaactgcaaaccttgtttcagtttatcgat
tactgcgacatgctcgattttaaggtcactgaaacccctgaactgattttgcactccaat
atgtcgggcgttgtcgctgacagcgataacttaattctgcgagccgcaaaatcattacag
caaaccacgggctttaacggtggcgctgagatctggctggataaacggctgcccatgggc
ggcggtttaggcggcggctcgtccgatgctgcgaccacattagtggcattgaacacgtta
tggcatacccaattatcgaccgaagaattggctaaaatcggccttaaattgggtgccgat
attcctgtttttattcatggtttcgccgcttttgccgaaggtgtgggtgaacgcttacaa
gcagtaaatccgagtgagccttggtacttagtcatagcacccgatgcccatgtttccacc
gccgacgtattccaagatccacttttaccgcgtgataccccgaaactggccatagatacc
ttaatgagccaaccttgggcaaatgattgtcaaaaactagtcgtttctaaataccctcaa
gttgccaaggcattaggctggctgctagaatatgcgccgtcgagaatgacaggaacaggc
gcatgcgtgttcggggaattcacacaacagcaacaagctctcgcagccttggcgaaatta
ccgtctgaaatgcaaggatttgttgcacaagggatgaatctttcgccgctcatcacgcga
ctcagtcacccttaa

DBGET integrated database retrieval system