KEGG   Shewanella baltica OS195: Sbal195_3807Help
Entry
Sbal195_3807      CDS       T00622                                 

Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
sbn  Shewanella baltica OS195
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal195_3807
   00670 One carbon pool by folate
    Sbal195_3807
Enzymes [BR:sbn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sbal195_3807
    1.5.1.-  
     Sbal195_3807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4487881..4488627)
Genome map
AA seq 248 aa AA seqDB search
MTSPIIITGVGKRIGYALAKHFLAQGQQVIGTYRSHYDSIDELNALGATLYPCDFYDDAQ
VQSLIDELTQLPQIRAIIHNASDWLPDPVLIKNEPLKSTTFTPSQVLQRMMQVHVSVPYQ
LNLALEAQLRAAAGDEIGGSDVIHITDYVAEKGSQKHIAYAASKAALHNMTLSFAAKFAP
EVKVNSIAPAMILFNMGDDAAYQQKTLAKALLPKEAGNAEIIELVDYLLNSRYVTGRCHN
VDGGRQLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcccatcataatcacaggcgtgggtaaacgcataggttacgccttagccaaa
cattttctcgcccaaggtcagcaggtgattggtacttatcgcagccattacgatagcatt
gatgagctgaacgctttaggtgcgactctgtatccctgcgatttttatgacgatgcccaa
gtgcaatccttaattgatgagttaactcaactgcctcaaattcgcgccattattcacaat
gcttcggactggctgccggatcctgttcttataaagaatgagcctttaaagagtaccact
tttacgccgagccaagtgctgcagcggatgatgcaagtgcatgtgagcgtgccctatcag
ttgaacttggccttagaggcgcagctacgtgccgctgctggcgatgaaatcggcggcagt
gatgtgattcatattacagactacgtggcagagaagggcagtcagaagcacatagcctat
gccgccagtaaagccgcgctgcacaatatgacgctatcctttgccgccaaatttgcgccc
gaggtgaaagtcaattcgattgcaccagcgatgatcctatttaatatgggtgatgacgcc
gcctatcagcaaaaaaccttagccaaagcgttattaccgaaagaggcggggaatgcggag
attatcgaactagtggactacctgctcaatagccgttacgtcaccggtcgttgccataat
gtcgacggcggccggcagttaaaatag

DBGET integrated database retrieval system