KEGG   Shewanella baltica OS195: Sbal195_4053Help
Entry
Sbal195_4053      CDS       T00622                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00010  Glycolysis / Gluconeogenesis
sbn00020  Citrate cycle (TCA cycle)
sbn00620  Pyruvate metabolism
sbn01100  Metabolic pathways
sbn01110  Biosynthesis of secondary metabolites
sbn01120  Microbial metabolism in diverse environments
sbn01130  Biosynthesis of antibiotics
sbn01200  Carbon metabolism
Module
sbn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal195_4053
   00020 Citrate cycle (TCA cycle)
    Sbal195_4053
   00620 Pyruvate metabolism
    Sbal195_4053
Enzymes [BR:sbn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sbal195_4053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H HlyD_D23 Peptidase_M23 RnfC_N PYNP_C HlyD_3
Motif
Other DBs
NCBI-ProteinID: ABX51213
UniProt: A9L5B9
Position
complement(4782964..4784961)
Genome map
AA seq 665 aa AA seqDB search
MAELKEVFVPDIGGDEVQVIEICVAVGDTLAAEESILTVESDKATMDIPAPFAGVLAELK
VAVGDKVSEGTLIAMMQAAGAAAAAPAPVAAPAQAAPASAPVQAAPAPVAAAPATGATKV
VEVTVPDIGGDTDVSVIEVLVAVGDKIEVDSGLITLETDKATMDVPSPFAGVVKDVKVAV
GDKVSQGSLVIMLEVGGAAPAAAPTVAAQAAPAAMVAPVAAAPAAPAASVVAVKEIQVPD
IGDASNVDVIEVLVSVGDEITADQGLITLETDKATMEVPAPFAGKLLSLTVKVGDKVSQG
SVIATIETVTVGAAPAAVAQAAAPAPVSAAPVAAPTPASRPPVPHHPSAGTPLSTGAVHA
SPAVRRLAREFGVDLTQVAGTGRKGRIMREDVQAYVKYELSRPKATAATSVGSGNGGGLQ
VIAAPKVDFSKFGEVEEIPLSRIQKISGPNLHRNWVTIPHVTQFDEADITEMEEFRKQQN
DVAAKKKADYKITPLVFMLKAVAKTLQQFPVFNSSLSSDGESLIQKKYFHIGVAVDTPNG
LVVPVVRDVDKKGIIELSRELADISIRARDGKLKSADMQGSCFTISSLGGIGGTAFTPIV
NYPDVAILGVSKSEIKPKWNGKEFEPKLMLPLSLSYDHRVIDGAMAARFSVTLSGILSDI
RTLVL
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaaaagaagtttttgttcctgatatcggcggcgatgaagtgcaagtgatc
gaaatttgtgtggctgtgggtgataccctagcggcagaagaatcgattcttaccgtcgaa
agcgacaaggcgactatggatattccagcgcctttcgccggtgttttagccgaattgaaa
gtggcggtgggcgataaagtatctgaaggtactttgattgctatgatgcaagcggcgggc
gcggcagctgccgctccggctccagttgcagcacccgctcaggcggcaccagcatctgca
ccagttcaagcggctccagccccagtggctgctgctcctgcgacgggcgcaaccaaagtg
gttgaagtgactgtacctgatatcggtggcgacactgatgtatcggttatcgaagtcctg
gttgctgtcggtgacaagattgaagttgatagcggtttaattaccctagaaacagacaaa
gcgacgatggacgtgccatcacctttcgcgggtgtggttaaagacgttaaagtcgcagtt
ggcgataaagtgtcgcaaggctctttagtcatcatgcttgaagttggcggcgctgcacct
gcagccgcgccaacggttgctgcccaagcggctcctgccgctatggtagcgccagtggcc
gcagcacctgctgcaccagcggcaagtgtggttgcggtaaaagaaattcaagtgcctgat
attggcgatgccagcaatgtcgatgtgatcgaagtgctcgtgtctgtcggtgatgaaatc
actgctgaccaaggtttgattacccttgaaactgacaaagccaccatggaagtgcctgcg
ccattcgccggtaaactgctgtctttgactgttaaagtgggtgacaaggtttctcaaggt
agcgttattgcaacgattgaaactgtcacagtgggtgcagctccagcagcggttgctcaa
gcggcagctcctgctccagtgagcgcggcgcccgttgcagccccaacaccagcaagccgt
cctccagtgccacaccacccaagcgcaggtacgcctttgtctaccggtgcggtacatgcg
tctcctgcggtacgtcgtttagcccgtgaatttggtgtcgacttgacccaagttgctggt
actggccgtaaaggtcgcattatgagagaagacgttcaggcgtatgtgaaatacgaactg
tctcgtccgaaagcaactgcggcaacctctgtgggttcaggtaacggcggcggtctgcaa
gttattgcagcacctaaagttgatttcagtaagtttggtgaagtggaagaaattccatta
agccgtatccagaagatttctggccctaacttacaccgcaactgggtaactattccgcac
gtgactcagttcgatgaagctgatatcactgaaatggaagagttccgtaagcagcaaaac
gatgtagcggcgaagaagaaagccgattacaagatcacgcctttagtgtttatgctaaaa
gctgtggctaaaacgttgcaacagttcccagtgttcaactcaagcttaagtagcgatggc
gaatcactgatccagaagaagtatttccatatcggtgtggcggttgatacgccaaacggt
ttggttgtgccagtcgtgcgtgacgtggataagaaaggcattatcgagttatctcgtgaa
ctggctgatatctctatccgtgcccgtgatggcaagctgaaatctgctgacatgcaaggt
agctgttttactatttctagtttaggtggcattggcggtacagcgtttacgcctatcgtt
aactacccagacgtggcgattttaggtgtgtctaaatctgaaattaagcctaagtggaat
ggtaaagagttcgaacctaaattgatgttgccattgtcgctgtcatacgatcaccgtgtg
atcgatggtgctatggctgcacgctttagtgtgacgctgtcaggaattctgtccgatatt
cgtactttggttctgtaa

DBGET integrated database retrieval system