KEGG   Shewanella baltica OS195: Sbal195_4435Help
Entry
Sbal195_4435      CDS       T00622                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbn  Shewanella baltica OS195
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal195_4435
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal195_4435
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal195_4435
Enzymes [BR:sbn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal195_4435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5243192..5243755
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQPNLNSLIAEEVLAVAQVNVTEHEKIANAKQFLDRLFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFNGTKDAPCAIVLQDLGCHVELSFDRNGMIGA
RDVANLEDIQIETSLNMIVGTPESRSAASRHWLSLLHAGMSSANDTQDKLFTAKDGSDYN
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaaccgaatctaaacagcctcatcgca
gaagaagtgctagccgtggcccaagtcaatgtcaccgagcacgagaagatcgctaatgcg
aaacaattcctcgaccgcctctttccacttaactctggttcacaccaagatgtgagcagc
tatgtggtttactaccaacacctgttggccttttttgccgacggcagccacagtggttta
cgtcagccaaaacagtttgtggcctttaacggcactaaagatgcgccttgcgccatagtg
ttgcaggacctaggttgccacgttgaactcagtttcgaccgcaatggcatgataggggcg
agagacgttgccaatctggaagatatccaaatcgaaacgtcattaaacatgatagtcgga
acaccagagtcacgttcagccgcatcgcgccattggctcagcctattacatgcgggtatg
tctagcgctaacgacacccaagataagttgtttaccgcaaaggatggcagcgattacaac
ttgaaaagtatcgtaaatttataa

DBGET integrated database retrieval system