KEGG   Shewanella baltica OS195: Sbal195_4435Help
Entry
Sbal195_4435      CDS       T00622                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbn  Shewanella baltica OS195
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal195_4435
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal195_4435
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal195_4435
Enzymes [BR:sbn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal195_4435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5243192..5243755
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQPNLNSLIAEEVLAVAQVNVTEHEKIANAKQFLDRLFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFNGTKDAPCAIVLQDLGCHVELSFDRNGMIGA
RDVANLEDIQIETSLNMIVGTPESRSAASRHWLSLLHAGMSSANDTQDKLFTAKDGSDYN
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaaccgaatctaaacagcctcatcgca
gaagaagtgctagccgtggcccaagtcaatgtcaccgagcacgagaagatcgctaatgcg
aaacaattcctcgaccgcctctttccacttaactctggttcacaccaagatgtgagcagc
tatgtggtttactaccaacacctgttggccttttttgccgacggcagccacagtggttta
cgtcagccaaaacagtttgtggcctttaacggcactaaagatgcgccttgcgccatagtg
ttgcaggacctaggttgccacgttgaactcagtttcgaccgcaatggcatgataggggcg
agagacgttgccaatctggaagatatccaaatcgaaacgtcattaaacatgatagtcgga
acaccagagtcacgttcagccgcatcgcgccattggctcagcctattacatgcgggtatg
tctagcgctaacgacacccaagataagttgtttaccgcaaaggatggcagcgattacaac
ttgaaaagtatcgtaaatttataa

DBGET integrated database retrieval system