KEGG   Shigella boydii Sb227: SBO_0104Help
Entry
SBO_0104          CDS       T00301                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase dihydrolipoyltransacetylase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbo  Shigella boydii Sb227
Pathway
sbo00010  Glycolysis / Gluconeogenesis
sbo00020  Citrate cycle (TCA cycle)
sbo00620  Pyruvate metabolism
sbo01100  Metabolic pathways
sbo01110  Biosynthesis of secondary metabolites
sbo01120  Microbial metabolism in diverse environments
sbo01130  Biosynthesis of antibiotics
sbo01200  Carbon metabolism
Module
sbo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBO_0104 (aceF)
   00020 Citrate cycle (TCA cycle)
    SBO_0104 (aceF)
   00620 Pyruvate metabolism
    SBO_0104 (aceF)
Enzymes [BR:sbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SBO_0104 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H NQRA HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABB64837
ShiBASE_China: SBO0104
UniProt: Q326C1
Position
114355..115944
Genome map
AA seq 529 aa AA seqDB search
MAIEIKVPDIGADEVEITEILVKVGDKVEAEQSLITVEGDKASMEVPSPQAGIVKEIKVS
VGDKTQTGALIMIFDSADGAADAAPAQAEEKKEAAPAAAPAAAAAKDVNVPDIGSDEVEV
TEILVKVGDKVEAEQSLITVEGDKASMEVPAPFAGTVKEIKVNVGDKVKTGSLIMIFEVE
GAAPAAAPAKQEAAAPAPAAKAEAPAAAPAAKAEGKSEFAENDAYVHATPLIRRLAREFG
VNLAKVKGTGRKGRILREDVQAYVKEAIKRAEAAPAATGGGIPGMLPWPKVDFSKFGEIE
EVELGRIQKISGANLSRNWVMIPHVTHFDKTDITELEAFRKQQNEEAAKRKLDVKITPVV
FIMKAVAAALEQMPRFNSSLSEDGQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIE
LSRELMTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAME
PVWNGKEFVPRLMLPISLSFDHRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaaagtaccggacatcggggctgatgaagttgaaatcaccgagatc
ctggtcaaagtgggcgacaaagttgaagccgaacagtcgctgatcaccgtagaaggcgac
aaagcctctatggaagttccgtctccgcaggcgggtatcgttaaagagatcaaagtctct
gttggcgataaaacccagaccggcgcactgattatgattttcgattccgccgacggtgca
gcagacgctgcacctgctcaggcagaagagaagaaagaagcagctccggcagcagcaccc
gcggctgcggcggcaaaagacgttaacgttccggatatcggcagcgacgaagttgaagtg
accgaaatcctggtgaaagttggcgataaagttgaagctgaacagtcgctgatcaccgta
gaaggcgataaagcttctatggaagttccggctccgtttgctggcaccgtgaaagagatc
aaagtgaacgtgggtgacaaagtgaaaactggctcgctgattatgatcttcgaagttgaa
ggcgcagcgcctgcggcagctcctgcgaaacaggaagcggcagcgccggcaccggcagca
aaagctgaagccccggcagcagcaccagctgcgaaagcggaaggcaaatctgaatttgct
gaaaacgacgcttatgttcacgcgactccgctgatccgccgtctggcacgcgagtttggt
gttaacctggcgaaagtgaagggcactggccgtaaaggtcgtatcctgcgcgaagacgtt
caggcttacgtgaaagaagctatcaaacgtgcagaagcagctccggcggcgactggcggc
ggtatcccaggcatgctgccgtggccgaaggtggacttcagcaagtttggtgaaatcgaa
gaagtggaactgggccgtatccagaaaatttctggtgctaacctgagccgtaactgggtg
atgatcccgcatgttacccacttcgacaaaaccgatatcaccgagctggaagcgttccgt
aaacagcagaacgaagaagcggcgaaacgtaagctggatgtgaagatcaccccggttgtc
ttcatcatgaaagccgttgctgcagctcttgagcagatgcctcgcttcaatagttcgctg
tcggaagacggtcagcgtctgactctgaagaaatacatcaacatcggtgtggcggtggat
accccgaacggtctggttgttccggtattcaaagacgtcaacaagaaaggcatcatcgag
ctgtctcgcgagctgatgactatttctaagaaagcgcgtgacggtaagctgactgcgggc
gaaatgcagggcggttgcttcaccatctccagcatcggcggcctgggtactacccacttc
gcgccgattgtgaacgcgccggaagtggctatcctcggcgtttccaagtccgcgatggag
ccggtgtggaatggtaaagagttcgtgccgcgtctgatgctgccgatttctctctccttc
gaccaccgcgtgatcgacggtgctgatggtgcccgtttcattaccatcattaacaacacg
ctgtctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system