KEGG   Shigella boydii Sb227: SBO_0372Help
Entry
SBO_0372          CDS       T00301                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sbo  Shigella boydii Sb227
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sbo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
387655..388260
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLSGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgctgttaacacagcttatggaagcactgcgctgtctgtcgggcgtt
ggcccgaagtcggcgcagcgtatggcgttcacgctgcttcagcgcgatcgtagcggcggg
atgcgtctggcgcaggcgctcacccgggcgatgtcggaaatcggccactgcgccgattgc
cgcactttcaccgaacaggaagtctgtaacatctgttcgaatccgcgtcgtcaggaaaac
ggtcaaatctgtgtggtggagagtccggcggacatctacgccattgagcagacggggcag
ttttctggtcgttattttgtgttgatggggcatctgtcaccgctggacggcatcggtccg
gatgatatcgggcttgatcgtctggaacagcgtctggcagaggaaaaaatcactgaagtg
atcctcgccaccaatcccacggttgaaggtgaagctaccgctaactacattgccgagctt
tgcgcgcaatatgacgtggaagctagccgaatcgctcatggcgtaccggttggcggcgaa
ctggaaatggtcgatggcaccacgctgtcacactcccttgccgggcgtcataagattcgt
ttttaa

DBGET integrated database retrieval system