KEGG   Shigella boydii Sb227: SBO_0610Help
Entry
SBO_0610          CDS       T00301                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sbo  Shigella boydii Sb227
Pathway
sbo00010  Glycolysis / Gluconeogenesis
sbo00260  Glycine, serine and threonine metabolism
sbo00680  Methane metabolism
sbo01100  Metabolic pathways
sbo01110  Biosynthesis of secondary metabolites
sbo01120  Microbial metabolism in diverse environments
sbo01130  Biosynthesis of antibiotics
sbo01200  Carbon metabolism
sbo01230  Biosynthesis of amino acids
Module
sbo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sbo_M00002  Glycolysis, core module involving three-carbon compounds
sbo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBO_0610 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SBO_0610 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBO_0610 (gpmA)
Enzymes [BR:sbo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SBO_0610 (gpmA)
Membrane trafficking [BR:sbo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SBO_0610 (gpmA)
Exosome [BR:sbo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SBO_0610 (gpmA)
  Exosomal proteins of melanoma cells
   SBO_0610 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: ABB65294
ShiBASE_China: SBO0610
UniProt: Q324G4
Position
complement(630495..631247)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNKENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGYSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLSEKELPLTESLALTIDRVIPYWNETILPRMKSGERVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPLKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggttctggttcgtcatggcgaaagtcagtggaacaaagaaaac
cgtttcaccggttggtacgacgtggatctgtctgagaaaggcgtaagcgaagcaaaagca
gcaggtaagctgctgaaagaggaaggttacagctttgactttgcttacacttctgtgctg
aaacgcgctatccataccctgtggaatgtgctggacgaactggatcaggcatggctgccc
gttgagaaatcctggaaactgaacgaacgtcactacggtgcgttgcagggtctgaacaaa
gcggaaactgctgaaaagtatggcgacgagcaggtgaaacagtggcgtcgtggttttgca
gtgactccgccggaactgactaaagatgatgagcgttatccgggtcacgatccgcgttac
gcgaaactgagcgagaaagaactgccgctgacggaaagcctggcgctgaccattgaccgc
gtgatcccttactggaatgaaactattctaccgcgtatgaagagcggtgagcgcgtaatc
atcgccgcacacggtaactccctgcgtgcgctggtgaaatatcttgataacatgagcgaa
gaagagattcttgagctgaatatcccgactggcgtgccgctggtgtatgagttcgacgag
aatttcaaaccgctgaaacgctattatctgggtaatgctgacgagatcgcagcgaaagca
gcggcggttgcaaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system