KEGG   Shigella boydii Sb227: SBO_1087Help
Entry
SBO_1087          CDS       T00301                                 

Gene name
yedO
Definition
(GenBank) putative 1-aminocyclopropane-1-carboxylate deaminase
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
sbo  Shigella boydii Sb227
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SBO_1087 (yedO)
Enzymes [BR:sbo01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     SBO_1087 (yedO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
ShiBASE_China: 
UniProt: 
Position
1096878..1097960
Genome map
AA seq 360 aa AA seqDB search
MTKKGAFTSAFFIYAFSACIIRKSQQHTSEAIMPLHNLTRFPRLEFIGAPTPLEYLPRFS
DYLGREIFIKRDDVTPMAMGGNKLRKLEFLAADALREGADTLITAGAIQSNHVRQTAAVA
AKLGLHCVALLENPIGTTAENYLTNGNRLLLNLFNTQIEMCDALTDPNAQLEELATRVEA
QGFRPYVIPVGGSNALGALGYVESALEIAQQCEGAVNISSVVVASGSAGTHAGLAVGLEH
LMPESELIGVTVSRSVADQLPKVVNLQQAIAKELELTASAEILLWDDYFAPGYGVPNDEG
MEAVKLLARLEGILLDPVYTGKAMAGLIDGISQKRFKDEGPILFIHTGGAPALFAYHPHV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaagggcgctttcactagcgccttttttatttacgcgttttcagcgtgcata
ataagaaaatcacaacaacacacatcggaggctattatgccactgcataatttaacccgt
tttccacggctggagtttatcggcgcgccaacgccgctcgaatatctgccgcgcttttct
gattatcttggacgggaaattttcatcaaacgggatgacgtcacacccatggcaatgggc
ggcaataaattacgtaagctggaatttctcgcggcagatgccctgcgcgaaggtgccgat
acgctgattactgccggcgcgatccagtctaaccatgtgcggcagactgccgcagttgcg
gcgaaactcggcctgcactgcgtggcgctgctggaaaatcctattggcacaaccgcagaa
aactatttaaccaacggcaatcgtttgttgctgaatctgttcaatacccagattgaaatg
tgcgacgcactgaccgatcccaatgcccaactggaagagctggcgacgcgagtcgaagca
caaggctttcgcccgtatgtcattccggttggcggttctaatgctctgggcgcgctgggt
tatgtggagagtgcgctggaaatcgcgcaacagtgtgaaggggcggttaatatttcgtcg
gtggtggtcgcatcgggcagtgccggaactcacgccggattggctgttgggctggaacac
ctgatgcctgaaagcgaactgattggcgtgaccgtgtcgcgttccgttgccgatcaattg
ccgaaagtggttaacctacaacaggcgattgcgaaagaactggagctgaccgcatcagcg
gaaattttactctgggatgactattttgcacctggctacggcgtgccgaacgacgaaggc
atggaagcagtgaaattgctggcgcgtctggaaggcattctgcttgatcctgtgtatacc
ggaaaagcgatggcggggctgattgacggtatcagtcagaaacgcttcaaagatgaaggg
ccgattctgtttattcataccggcggcgcgcctgcgctgttcgcctatcatccccacgtt
tag

DBGET integrated database retrieval system