KEGG   Shigella boydii Sb227: SBO_1117Help
Entry
SBO_1117          CDS       T00301                                 

Gene name
cheB
Definition
protein methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sbo  Shigella boydii Sb227
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SBO_1117 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SBO_1117 (cheB)
Enzymes [BR:sbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SBO_1117 (cheB)
Two-component system [BR:sbo02022]
 CheA family
  CheA-CheYBV
   SBO_1117 (cheB)
Bacterial motility proteins [BR:sbo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SBO_1117 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
1121368..1122306
Genome map
AA seq 312 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAAKASLAAHKPLSAPTTLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPALLITQHMPPGFTRSFADRLNKLCQIGVKEAEDGERVLPGHAYIAPGDRHMELARSG
ANYQIKIHDGPVGMLAMRQAGAWTLAQNEASCVVFGMPREAINMGGVCEVVDLSQVSQQM
LAKISAGQAIRI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcagggtgttatctgtcgatgattcggcactgatgcgccagatcatgaca
gaaatcatcaacagccatagcgacatggaaatggtggcgaccgcgcctgatccgctggtc
gcgcgtgacttgattaagaaattcaatcccgatgtgctgacgctggatgttgaaatgccg
cggatggacggactggatttcctcgaaaaattaatgcgtttgcgtccaatgcccgttgtg
atggtttcttccttgaccggcaaaggatcagaagtcacgctgcgcgcgctggagctgggg
gcaatagattttgtcaccaaaccgcaactgggtattcgcgaaggaatgctggcgtatagc
gaaatgattgctgaaaaggtgcgtacggcagcaaaggcgagccttgcagcacataagcca
ttgtcagcaccgacaacgctgaaggcgggtccgttgttgagttctgaaaaactgattgcg
attggtgcttcaacgggtggaactgaggcaattcgtcacgtactgcaaccgttgccgctt
tccagcccggcattgttaattacccaacatatgccgcccggtttcacccgctcttttgcc
gacagacttaataagctttgccagatcggggttaaagaagccgaagacggagaacgtgtc
ttgccggggcatgcctatattgcgccgggcgatcggcatatggaactggcgcgtagtggc
gcaaattatcaaatcaaaattcacgacggcccggtgggaatgttggcgatgcgtcaggcg
ggggcatggacccttgcgcaaaacgaagcaagttgcgtggtgttcggcatgccgcgcgag
gccatcaatatgggtggtgtctgcgaagtggtcgatcttagccaggtaagccagcaaatg
ttggcaaaaattagtgccggacaggcgatacgtatttaa

DBGET integrated database retrieval system