KEGG   Shigella boydii Sb227: SBO_1319Help
Entry
SBO_1319          CDS       T00301                                 

Gene name
ydjB
Definition
(GenBank) conserved hypothetical protein
  KO
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sbo  Shigella boydii Sb227
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SBO_1319 (ydjB)
Enzymes [BR:sbo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SBO_1319 (ydjB)
    3.5.1.-  
     SBO_1319 (ydjB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
ShiBASE_China: 
UniProt: 
Position
complement(1303184..1303843)
Genome map
AA seq 219 aa AA seqDB search
MIKETAMPHRALLLVDLQNDFCAGGALAVPEGDSTVEVANRLIDWCQSRGEAVIASQDWH
PANHGSFASQHGVEPYTPGQLDGLPQTFWPDHCVQNSEGAQLHPLLNQKAIAAVFHKGEN
PLVDSYSAFFDNGRRQKTSLDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVI
TDGCRGVNIQPQDSAHAFMEMSAAGATLYTLADWEETQG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggagactgcaatgccccatcgcgccctgttactggtcgatttacaaaatgat
ttctgtgctggtggcgcgctcgccgtaccggaaggtgacagtacggtggaggttgctaac
cgccttattgactggtgccagtcgcgcggagaagcggttatcgccagccaggactggcat
ccggcgaatcacggcagttttgccagtcagcacggtgtagagccttatacgccaggccaa
ctcgacggtttgccacaaaccttctggccagatcactgtgtgcagaacagtgaaggcgca
caattacatccgttactgaaccaaaaagcgatcgcagcggtgttccataaaggcgaaaat
cctttagttgacagttacagtgccttttttgataacggccgtcggcagaaaacctctctc
gatgactggttacgcgatcatgaaatcgatgaattgatcgttatgggcctggctactgac
tattgcgtgaagtttaccgtgctggacgcgttacagttaggttataaggtgaacgtgatt
accgatggttgtcgtggcgtgaatatccagccccaggacagtgcacacgcgtttatggag
atgtcagcagctggggcaacgctatatacgctggcagactgggaagagacacaggggtaa

DBGET integrated database retrieval system