KEGG   Shigella boydii Sb227: SBO_1367Help
Entry
SBO_1367          CDS       T00301                                 

Gene name
pfkB
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
sbo  Shigella boydii Sb227
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBO_1367 (pfkB)
   01230 Biosynthesis of amino acids
    SBO_1367 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBO_1367 (pfkB)
   00030 Pentose phosphate pathway
    SBO_1367 (pfkB)
   00051 Fructose and mannose metabolism
    SBO_1367 (pfkB)
   00052 Galactose metabolism
    SBO_1367 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    SBO_1367 (pfkB)
Enzymes [BR:sbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SBO_1367 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(1344653..1345582)
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISASQKQGIRCIVDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattaccccg
caaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggcgcgaccggcgaacacctggtttcactgttggcggatgaaaatgtccccgtc
gctactgtagaagccaaagactggacccggcagaatttacatgtacatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggggccatcctagtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgcttcgcaaaaacaaggg
atccgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcaattggtaac
atcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactcacc
cagccggacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacgg
gttgtcgtttcccttggtccacaaggagcgctgggtgttgatagtgaaaactgcattcag
gtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttgaagagatggtccgttttggcgta
gctgcggggagtgcagccacactcaatcagggaacacgtctgtgctcccatgacgatacg
caaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system