KEGG   Shigella boydii Sb227: SBO_1924Help
Entry
SBO_1924          CDS       T00301                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sbo  Shigella boydii Sb227
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(1903221..1903754)
Genome map
AA seq 177 aa AA seqDB search
MNTKIKYGLSAAVLALIAAGAPAPEILDQFLDEKEGNHTTAYRDGAGIWTICRGAILVDS
KPVVPGMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYRRINAGDRRGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALACWDIDR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccaaaatcaaatacggcctgtcggctgccgttctggcgctgattgccgcaggt
gcgcctgcgcctgaaatcctcgaccagtttctggatgaaaaggaaggtaaccacaccacg
gcataccgtgatggcgcgggtatctggaccatctgccgcggtgccatcctggtggatagt
aaacctgtcgtcccgggcatgaagttgtcgaaggaaaaatgcgaccaggtcaacgccatt
gagcgtgataaggcgctggcatgggtggagcgcaatattaaagtgccgctgaccgaaccc
cagaaagcgggtatcgcgtcattttgtccctataacattggccccggtaagtgtttcccg
tcgacgttttacagacggattaatgctggtgaccgcaggggagcatgcgaagcgattcgc
tggtggattaaggacggtggcagagactgccgtatccgctcaaataattgctacggtcag
gtatcccggcgagaccaggaaagtgcgctggcgtgctgggacatcgacagataa

DBGET integrated database retrieval system