KEGG   Shigella boydii Sb227: SBO_2055Help
Entry
SBO_2055          CDS       T00301                                 

Gene name
glpQ
Definition
glycerophosphodiester phosphodiesterase (EC:3.1.4.46)
Orthology
K01126  
glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
sbo  Shigella boydii Sb227
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SBO_2055 (glpQ)
Enzymes [BR:sbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     SBO_2055 (glpQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
2028612..2029688
Genome map
AA seq 358 aa AA seqDB search
MKLTLKNLSMAIMMSTIVMGSSAMAADSNEKIVIAHRGASGYLPEHTLPAKAMAYAQGAD
YLEQDLVMTKDDHLVVLHDHYLDRVTDVADRFPDRARKDGRYYAIDFTLDEIKSLKFTEG
FDIENGKKVQTYPGRFPMGKSDFRVHTFEEEIEFVQGLNHSTGKNIGIYPEIKAPWFHHQ
EGKDIAAKTLEVLKKYGYTGKDDKVYLQCFDADELKRIKNELEPKMGMELNLVQLIAYTD
WNETQQKQPDGSWVNYNYDWMFKPGAMKQVAEYADGIGPDYHMLIEETSQPGNIKLTGMV
QDAQQNKLVVHPYTVRSDKLPEYTPDVNQLYDALYNKAGVNGLFTDFPDKAVKFLNKE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgacgctgaaaaaccttagcatggcgatcatgatgagcactatagtcatggga
agcagtgcaatggcggcggacagcaacgaaaaaatagtcatcgcccatcgcggtgccagt
ggatatttgccggagcatacgctgccagcaaaagcgatggcgtatgcgcagggagcggat
tatctggaacaggatttggtgatgaccaaagacgaccatctggttgttctgcatgaccat
tatctcgatcgtgttactgatgttgccgatcgtttcccggatcgggcgcgcaaagacggt
cgttactacgcgatagatttcacgctggatgaaattaagtcgttgaaatttaccgaaggt
ttcgatattgaaaacggtaaaaaagtgcagacttatccggggcgtttcccaatgggtaag
tccgacttccgggtgcacacctttgaagaagagattgaatttgttcaggggttaaatcac
tctaccgggaaaaatatcggtatttatccagaaatcaaagcgccgtggttccatcatcag
gaagggaaggatattgcggcaaaaacgctggaagtgctgaagaaatatggttacaccggt
aaagacgataaagtttatttgcaatgttttgatgctgatgagctgaagcgtattaagaat
gagctggaacccaaaatgggcatggagctcaatctggtacagctgattgcctataccgac
tggaatgaaacgcagcagaaacagccggatggaagctgggttaattacaactacgactgg
atgtttaagccgggtgccatgaaacaggtggcggaatatgcagatggtattggtccggat
taccatatgttgattgaggagacatcgcagccgggtaatatcaaactcactggcatggtg
caagatgctcagcagaataaactggtagtgcatccttataccgtgcggtcagataaactg
cctgaatacactcctgatgtgaatcagttatatgatgctctgtataacaaagcgggtgta
aatgggctgtttactgatttccctgataaggcagtaaaatttcttaataaagagtaa

DBGET integrated database retrieval system