KEGG   Shigella boydii Sb227: SBO_2055Help
Entry
SBO_2055          CDS       T00301                                 

Gene name
glpQ
Definition
glycerophosphodiester phosphodiesterase (EC:3.1.4.46)
Orthology
K01126  
glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
sbo  Shigella boydii Sb227
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sbo00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
2028612..2029688
Genome map
AA seq 358 aa AA seqDB search
MKLTLKNLSMAIMMSTIVMGSSAMAADSNEKIVIAHRGASGYLPEHTLPAKAMAYAQGAD
YLEQDLVMTKDDHLVVLHDHYLDRVTDVADRFPDRARKDGRYYAIDFTLDEIKSLKFTEG
FDIENGKKVQTYPGRFPMGKSDFRVHTFEEEIEFVQGLNHSTGKNIGIYPEIKAPWFHHQ
EGKDIAAKTLEVLKKYGYTGKDDKVYLQCFDADELKRIKNELEPKMGMELNLVQLIAYTD
WNETQQKQPDGSWVNYNYDWMFKPGAMKQVAEYADGIGPDYHMLIEETSQPGNIKLTGMV
QDAQQNKLVVHPYTVRSDKLPEYTPDVNQLYDALYNKAGVNGLFTDFPDKAVKFLNKE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgacgctgaaaaaccttagcatggcgatcatgatgagcactatagtcatggga
agcagtgcaatggcggcggacagcaacgaaaaaatagtcatcgcccatcgcggtgccagt
ggatatttgccggagcatacgctgccagcaaaagcgatggcgtatgcgcagggagcggat
tatctggaacaggatttggtgatgaccaaagacgaccatctggttgttctgcatgaccat
tatctcgatcgtgttactgatgttgccgatcgtttcccggatcgggcgcgcaaagacggt
cgttactacgcgatagatttcacgctggatgaaattaagtcgttgaaatttaccgaaggt
ttcgatattgaaaacggtaaaaaagtgcagacttatccggggcgtttcccaatgggtaag
tccgacttccgggtgcacacctttgaagaagagattgaatttgttcaggggttaaatcac
tctaccgggaaaaatatcggtatttatccagaaatcaaagcgccgtggttccatcatcag
gaagggaaggatattgcggcaaaaacgctggaagtgctgaagaaatatggttacaccggt
aaagacgataaagtttatttgcaatgttttgatgctgatgagctgaagcgtattaagaat
gagctggaacccaaaatgggcatggagctcaatctggtacagctgattgcctataccgac
tggaatgaaacgcagcagaaacagccggatggaagctgggttaattacaactacgactgg
atgtttaagccgggtgccatgaaacaggtggcggaatatgcagatggtattggtccggat
taccatatgttgattgaggagacatcgcagccgggtaatatcaaactcactggcatggtg
caagatgctcagcagaataaactggtagtgcatccttataccgtgcggtcagataaactg
cctgaatacactcctgatgtgaatcagttatatgatgctctgtataacaaagcgggtgta
aatgggctgtttactgatttccctgataaggcagtaaaatttcttaataaagagtaa

DBGET integrated database retrieval system