KEGG   Shigella boydii Sb227: SBO_2980Help
Entry
SBO_2980          CDS       T00301                                 

Gene name
tdcD
Definition
propionate/acetate kinase (EC:2.7.2.15)
Orthology
K00932  
propionate kinase [EC:2.7.2.15]
Organism
sbo  Shigella boydii Sb227
Pathway
Propanoate metabolism
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sbo00640]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(2984560..2985780)
Genome map
AA seq 406 aa AA seqDB search
MRKEMNEFPVVLVINCGSSSIKFSVLDASDCEVLMSGIADGINSENAFLSVNGGEPAPLA
HHSYEGALKAIAFELEKRNLNDSVALIGHRIAHGGSIFTESAIITDEVIDNIRRVSPLAP
LHNYANLSGIESAQQLFPGVTQVAVFDTSFHQTMAPEAYLYGLPWKYYEELGVRRYGFHG
TSHRYVSQRAHSLLNLAEDDSGLVVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTR
SGDVDFGAMSWVASQTNQSLGDLERVVNKESGLLGISGLSSDLRVLEKAWHEGHERAQLA
IKTFVHRIARHIAGHAASLRRLDGIIFTGGIGENSSLIRRLVMEHLAVLGVEIDTEMNNR
SNSCGERIVSSENARVICAVIPTNEEKMIALDAIHLGKVNAPAEFA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagagatgaatgaatttccggttgttttggttattaactgtggttcgtcttcg
attaagttttccgtactcgatgccagcgactgtgaagtattaatgtcaggtattgccgac
ggtattaactcagaaaatgcattcttatccgtaaatgggggagagccagcaccgctggct
caccacagctacgaaggtgcattgaaggcaattgcatttgaactggaaaaacggaattta
aatgacagtgtggccttaattggccaccgcatcgctcacggcggcagtatttttaccgag
tccgccattattaccgatgaggtcattgataatatccgtcgcgtttctccactggcaccc
ctgcataattacgccaatttaagtggtattgaatcggcgcagcaattatttccgggcgta
actcaggtggcggtatttgataccagtttccaccagacgatggctccggaagcttattta
tacggcctgccgtggaaatattatgaagagttaggtgtacgccgttatggtttccacggc
acgtcgcaccgctatgtttcccagcgcgcacattctttgctgaatctagcggaagatgac
tccggcctggttgtggcgcatcttggcaatggcgcgtcaatctgcgcagttcgcaacggt
cagagtgttgacacctcaatgggaatgacgccgctggaaggcttgatgatgggtacccgc
agtggcgatgtcgattttggtgcgatgtcctgggtcgccagccaaaccaaccagagcttg
ggtgacctggaacgcgtagtgaataaagagtcgggattattaggtatttccggtctttct
tcggatttacgtgttctggaaaaagcctggcatgaaggtcacgaacgcgcgcaactggca
attaaaacctttgttcaccgaattgcccgtcatattgccggacacgcagcttcattacgt
cgcctggatggaattatattcaccggcggaataggagagaattcaagcttaattcgtcgt
ctggtcatggaacatttggctgtattaggcgtagagattgatacagaaatgaataatcgc
tctaactcctgtggtgagcgaattgtttccagtgaaaatgcgcgtgtcatttgcgctgtt
attccgactaacgaagaaaaaatgattgctttggatgccattcatttaggcaaagttaac
gcgcccgcagaatttgcataa

DBGET integrated database retrieval system