KEGG   Shigella boydii Sb227: SBO_3091Help
Entry
SBO_3091          CDS       T00301                                 

Gene name
bglA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sbo  Shigella boydii Sb227
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBO_3091 (bglA)
Enzymes [BR:sbo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SBO_3091 (bglA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(3093372..3094811)
Genome map
AA seq 479 aa AA seqDB search
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVLPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDSLFDE
LLKYNIEPVITLSHFEIPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHDNPEETMYQVLHHQFVASALAVKAARRINPEMKVGC
MLAMVPLYPYSCNPDDVMFAQESMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMINAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQRPLFIVENGFGAYDKVEEDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGEKL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggtggcgccgttgccgct
catcaggtcgaaggcggctggaacaaaggcggcaaaggaccgagcatttgtgacgttctg
accggtggcgcacacggcgtgccgcgcgaaatcaccaaagaagtcttgccaggaaaatac
tatccaaaccatgaagccgttgatttttatggtcactacaaggaagacatcaagctattt
gccgaaatgggcttcaaatgttttcggacttccatcgcctggacgcgtatttttccaaaa
ggtgatgaagctcagccaaacgaagaagggctgaagttttacgactctctgttcgatgaa
ctgctgaaatacaacatcgaaccggtgataaccctctcccactttgaaataccgctgcat
ctggtgcagcaatacggtagctggaccaaccgtaaagtcgttgatttctttgtccgtttc
gcggaagtggtattcgaacgctacaagcataaagtcaaatactggatgaccttcaacgaa
ataaacaaccagcgtaactggcgtgcgccgctgtttggttactgctgctccggcgtggtg
tataccgagcatgacaacccggaagagacgatgtaccaggtgctgcatcaccagtttgtc
gccagcgccctagcagtgaaagccgcgcgtcgcattaacccggagatgaaagtcggctgt
atgctggcgatggtgccgctctatccttactcctgtaacccggacgatgtgatgttcgct
caggagtcgatgcgcgaacgctacgtctttaccgatgtgcagctacgcggctattacccg
tcctatgtgttgaacgagtgggagcgtcgcggatttaacatcaaaatggaagatggcgat
ctggatgtactgcgtgaaggcacctgcgattatcttggtttcagctattacatgatcaac
gcagtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccg
aacccgtatgttaaagcgtctgactggggctggcagattgatccagtaggtctgcgctat
gccctttgcgaactgtatgagcgttatcagaggccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagaagatggcagcatcaacgacgactaccgcattgactac
ctgcgcgcccatattgaagagatgaaaaaagcagtgacttacgatggtgtggatctgatg
ggctacacaccgtggggctgcatcgactgcgtgtcattcactaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttaactggtacaaagaggtgattgccagcaacggcgagaagctttaa

DBGET integrated database retrieval system