KEGG   Shigella boydii Sb227: SBO_3099Help
Entry
SBO_3099          CDS       T00301                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sbo  Shigella boydii Sb227
Brite
Enzymes [BR:sbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SBO_3099 (dsbC)
Secretion system [BR:sbo02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   SBO_3099 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
3099651..3100361
Genome map
AA seq 236 aa AA seqDB search
MKKGFMLFTLLAAFSGFAQADDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYIT
DDGKHIIQGPMYDVSGAAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGY
CHKLHEQMADYNALGITVRYLAFPRQGLESQAEQQMKAIWCAKDKNKAFDDVMAGKAATP
ASCDIDIADHYALGVQLGVSGTPAIVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGN
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaggttttatgttgtttactttgttagcggcgttttcaggctttgctcaggct
gatgacgcggcaattcaacaaacgttagccaaaatgggcattaaaagcagcgatattcag
ccagcacccgtggctggcatgaagactgtgctgactaacagcggtgtgttgtacatcacc
gatgacggtaaacatatcattcaggggccaatgtatgacgttagtggcgcggctccggtc
aatgtcaccaataaaatgctgctaaagcagttgaatgcgcttgaaaaagagatgatcgtt
tataaagcgccgcaggaaaaacacgtcatcaccgtgtttactgatattacctgtgggtac
tgccacaaactgcatgagcaaatggcagactacaacgcgctggggatcaccgtgcgttat
cttgctttcccgcgccaggggctggagagccaggctgagcaacaaatgaaagccatctgg
tgtgcgaaagataaaaacaaagcgtttgatgatgtgatggctggtaaagctgccactccg
gcaagttgcgatatcgatattgccgatcattacgcacttggcgtccagcttggcgttagc
ggcactccggcaattgtgctgagcaatggcacacttgttccgggttaccagccgccgaaa
gagatgaaagaattcctcgacgaacaccaaaaaatgaccagcggtaattaa

DBGET integrated database retrieval system