KEGG   Shigella boydii Sb227: SBO_3170Help
Entry
SBO_3170          CDS       T00301                                 

Gene name
gltB
Definition
glutamate synthase subunit alpha (EC:1.4.1.13)
Orthology
K00265  
glutamate synthase (NADPH/NADH) large chain [EC:1.4.1.13 1.4.1.14]
Organism
sbo  Shigella boydii Sb227
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbo01230]
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:sbo00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sbo00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(3175952..3180505)
Genome map
AA seq 1517 aa AA seqDB search
MTRNPRRHALSVPVRSGSEVGFPQSLGEVHDMLYDKSLERDNCGFGLIAHIEGEPSHKVV
RTAIHALARMQHRGAILADGKTGDGCGLLLQKPDRFFRIVAQERGWRLAKNYAVGMLFLN
KDPELAAAARRIVEEELQRETLSIVGWRDVPTNEGVLGEIALSSLPRIEQIFVNAPAGWR
PRDMERRLFIARRRIEKRLEADKDFYVCSLSNLVNIYKGLCMPADLPRFYLDLADLRLES
AICLFHQRFSTNTVPRWPLAQPFRYLAHNGEINTITGNRQWARARTYKFQTPLIPDLHDA
APFVNETGSDSSSMDNMLELLLAGGMDIIRAMRLLVPPAWQNNPDMDPELRAFFDFNSMH
MEPWDGPAGIVMSDGRFAACNLDRNGLRPARYVITKDKLITCASEVGIWDYQPDEVVEKG
RVGPGELMVIDTRSGRILHSAETDDDLKSRHPYKEWMEKNVRRLVPFEDLPDEEVGSREL
DDDTLASYQKQFNYSAEELDSVIRVLGENGQEAVGSMGDDTPFAVLSSQPRIIYDYFRQQ
FAQVTNPPIDPLREAHVMSLATSIGREMNVFCEAEGQAHRLSFKSPILLYSDFKQLTTMK
EEHYRADTLDITFDVTKTTLEATVKELCDKAEKMVRSGTVLLVLSDRNIAKDRLPVPAPM
AVGAIQTRLVDQSLRCDANIIVETASARDPHHFAVLLGFGATAIYPYLAYETLGRLVDTH
AIAKDYRTVMLNYRNGINKGLYKIMSKMGISTIASYRCSKLFEAVGLHDDVVGLCFQGAV
SRIGGASFEDFQQDLLNLSKRAWLARKPISQGGLLKYVHGGEYHAYNPDVVRTLQQAVQS
GEYSDYQEYAKLVNERPATTLRDLLAITPGENAVNIADVEPASELFKRFDTAAMSIGALS
PEAHEALAEAMNSIGGNSNSGEGGEDPARYGTNKVSRIKQVASGRFGVTPAYLVNADVIQ
IKVAQGAKPGEGGQLPGDKVTPYIAKLRYSVPGVTLISPPPHHDIYSIEDLAQLIFDLKQ
VNPKAMISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGTGASPLSSVKYAGCPWELGL
VETQQALVANGLRHKIRLQVDGGLKTGVDIIKAAILGAESFGFGTGPMVALGCKYLRICH
LNNCATGVATQDDKLRKNHYHGLPFKVTNYFEFIARETRELMAQLGVTRLVDLIGRTDLL
KELDGFTAKQQKLALSKLLETAEPHPGKALYCTENNPPFDNGLLNAQLLQQAKPFVDERQ
SKTFWFDIRNTDRSVGASLSGYIAQTHGDQGLAADPIKAYFNGTAGQSFGVWNAGGVELY
LTGDANDYVGKGMAGGLIAIRPPVGSAFRSHEASIIGNTCLYGATGGRLYAAGRAGERFG
VRNSGAITVVEGIGDNGCEYMTGGIVCILGKTGVNFGAGMTGGFAYVLDESGDFRKRVNP
ELVEVLNVDDLAIHEEHLRGLITEHVQHTGSQRGEEILANWSTFATKFALVKPKSSDVKA
LLGHRSRSAAELRVQAQ
NT seq 4554 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcaacccccgtcgccacgctctttctgtgcccgtgcgcagcggttcggaagtg
gggttcccgcagagcctgggggaggttcacgatatgttgtacgataaatcccttgagagg
gataactgtggtttcggcctgatcgcccacatagaaggcgaacctagccacaaggtagtg
cgtactgcaatacacgcactggcccgcatgcagcaccgtggcgcgattctcgccgatggt
aaaaccggtgacggttgcggcttgctgttacaaaaaccggatcgcttttttcgcatcgtt
gcgcaggagcgcggctggcgtttagcaaaaaactacgctgtcgggatgctcttcctgaat
aaagatcctgaactcgcggctgccgcacgccgcatcgttgaagaagagctgcaacgcgaa
accttgtcgattgtgggctggcgtgatgtccccactaacgaaggcgtgctgggtgaaatc
gccctctcctctctgccccgcattgagcaaattttcgttaacgctccggcaggctggcgt
ccgcgggatatggagcgccgtctgtttatcgcccgccgccgcattgaaaagcgtctcgaa
gccgacaaagacttctacgtctgtagcctgtcgaatctggtgaacatctataaaggtctg
tgtatgccggcggatctgccgcgcttttatctggatcttgcggacctgcgtctggaatcg
gccatctgcctgttccaccagcgcttctccactaacaccgtaccgcgctggccgctggcg
cagccgttccgctacctggcgcataacggtgaaatcaacaccatcaccggtaaccgccaa
tgggcgcgtgcgcgtacctataaattccagacgccgcttatccctgatctgcacgacgcc
gcaccgttcgtcaacgaaaccggctctgactccagttcgatggataacatgctggaactg
ctgctggcaggcgggatggatatcatccgcgccatgcgtctgttagtgccacccgcctgg
cagaacaacccggatatggacccggaactgcgtgccttctttgactttaactccatgcat
atggagccgtgggatggcccggcgggcatcgtgatgtccgacggtcgttttgccgcctgt
aacctcgaccgtaacggtctgcgtccggcgcgctacgtcatcaccaaagataagctcatc
acctgcgcctctgaagtcggtatctgggattaccagcctgacgaagtggtcgaaaaaggc
cgcgtcgggccaggcgaactgatggttatcgacacccgcagtgggcgtattctgcactcg
gcagaaaccgatgacgatctgaaaagccgccatccatataaagagtggatggagaaaaac
gtccgccgactggtaccgtttgaagatctgcccgatgaagaagtgggtagccgcgaattg
gacgacgacacgcttgccagctaccagaaacagtttaactacagtgcggaagagctggac
tccgtaattcgcgtactgggcgaaaacggtcaggaagcggtcggttcgatgggcgatgat
accccattcgccgtgctctccagtcagccgcgcattatttacgactacttccgccagcag
tttgcccaggtgactaacccgccaatcgacccgctgcgtgaagcgcatgttatgtcgctc
gccaccagtatcggtcgtgaaatgaacgtcttttgcgaagcagagggccaggcgcaccgt
ttaagctttaaatcgccgattctgctctactccgatttcaaacagctcacgacgatgaaa
gaggagcactaccgcgcagatacgctggatatcacctttgacgtcactaaaaccacgctc
gaagcgacagtcaaagagctgtgcgacaaagccgaaaaaatggtacgtagcggcaccgtg
ctgctggtgctctccgaccggaatatcgctaaagatcgcctgccggttccagccccgatg
gcggttggcgcgatccagacccgtctggtcgatcaaagcctgcgttgcgatgccaacatc
atcgtcgaaaccgccagcgcccgcgatccgcaccacttcgccgtgttgctgggcttcggc
gcgacggctatttatccataccttgcctatgaaacgctgggccgcctggtagacacccat
gcgattgccaaagattatcgtaccgtgatgctcaactaccgtaacggcatcaacaaaggc
ttgtacaaaatcatgtccaaaatgggcatctccaccatcgcctcttaccgctgctcgaaa
ctgtttgaagcggtcggtctgcacgatgatgtagtgggcctgtgcttccagggggcggtc
agccgcattggtggggcgagctttgaagacttccagcaggatctgctgaacctgtcgaaa
cgtgcctggctggcgcgtaagcccatcagccagggcggcctgctgaaatacgtccacggc
ggcgaataccacgcttacaacccggacgtggtgcgcacgctgcaacaggcggtacaaagc
ggcgagtacagcgactatcaggaatacgcgaagctggttaatgagcgtccggcaaccacg
ctgcgcgatctgctggcaattacgccgggtgaaaacgcggtcaacattgctgatgttgaa
ccggcaagcgaactgtttaaacgctttgataccgccgcgatgtctatcggcgcgttaagc
ccggaagcccacgaggcgctggcggaagcgatgaatagcatcggcggtaactcgaactcc
ggtgaaggcggcgaagacccggcgcgctatggcactaacaaagtgtcgcgcatcaagcag
gtggcttctggtcgcttcggcgttactccggcgtatctggtcaatgccgacgtcattcag
attaaagtcgcccagggcgcgaagccgggcgaaggcggtcagttgccgggcgacaaagtc
actccttacatcgccaaactgcgctattcggtgcccggagtgacgctgatctccccgccg
ccgcaccacgatatctactctatcgaggacttagcgcagctcattttcgacctcaagcag
gttaacccgaaagcgatgatctccgtgaagctggtttccgaaccgggcgtaggcaccatc
gcgactggcgtggcaaaagcttatgccgatttaatcaccatcgcaggctatgacggtggc
accggcgcaagcccgctgtcgtcagtgaaatacgcaggttgcccgtgggagctggggctt
gttgaaacccagcaggcgctggttgccaatggtctgcgtcataagatccgtttgcaggtc
gatggcggcctgaaaaccggtgttgatatcatcaaagcggcgattctcggcgcagaaagc
ttcggcttcggcactggcccaatggtcgcgctcggctgtaaatatctgcgtatttgccac
ctgaacaactgcgcaacgggtgtggcaactcaggatgacaaactgcgtaagaatcactat
cacggcctgccgttcaaggtgacgaattactttgagtttatcgcccgtgaaacccgcgag
ctgatggcacagctgggggtaacgcggctggtggatctgattggtcgcaccgacctgctg
aaagagctggacggtttcaccgccaaacagcagaaactggcgctgtcgaagctgctggag
accgccgaaccgcatccaggtaaggcactctactgcaccgaaaacaacccgccgtttgat
aacggcctgctgaacgcgcagttgctgcaacaggcgaaaccgtttgtcgatgaacgccag
agcaaaaccttctggttcgatatccgcaataccgatcgctccgtgggcgcgtcgctttca
ggctatatcgcccagacgcacggcgatcaggggctggcagccgatcctatcaaagcgtac
ttcaacggcaccgcaggccagagtttcggtgtatggaacgcgggcggcgtggaactgtac
ctgaccggggatgccaacgactatgtcggtaaaggcatggcgggcggcttaatcgccatt
cgtcctccggttggttccgccttccgcagccatgaagcaagtattatcggcaacacctgc
ctgtatggcgcgaccggtggtcgtctgtatgccgcaggccgcgcgggtgaacgtttcggc
gtgcggaactccggtgctatcaccgtggtagaaggcattggcgacaacggctgtgaatat
atgacgggcggtattgtctgtattctgggtaaaaccggcgttaacttcggtgcgggcatg
accggcggcttcgcttacgttctcgatgaaagcggtgatttccgcaaacgcgttaacccg
gaactggtcgaggtcttaaacgttgacgatctggcgatccatgaagagcatctgcgcggt
cttatcaccgagcatgttcagcatactggctctcagcgcggtgaagagattctggcgaac
tggtcaaccttcgccactaaatttgcgctggttaaaccgaagtccagtgatgtaaaagca
ctgctgggtcaccgtagtcgtagcgcagcagagttgcgcgtgcaggcgcagtaa

DBGET integrated database retrieval system