KEGG   Shigella boydii Sb227: SBO_3170Help
Entry
SBO_3170          CDS       T00301                                 

Gene name
gltB
Definition
glutamate synthase subunit alpha (EC:1.4.1.13)
Orthology
K00265  
glutamate synthase (NADPH/NADH) large chain [EC:1.4.1.13 1.4.1.14]
Organism
sbo  Shigella boydii Sb227
Pathway
Alanine, aspartate and glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SBO_3170 (gltB)
  Energy metabolism
   00910 Nitrogen metabolism
    SBO_3170 (gltB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SBO_3170 (gltB)
Enzymes [BR:sbo01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     SBO_3170 (gltB)
    1.4.1.14  glutamate synthase (NADH)
     SBO_3170 (gltB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(3175952..3180505)
Genome map
AA seq 1517 aa AA seqDB search
MTRNPRRHALSVPVRSGSEVGFPQSLGEVHDMLYDKSLERDNCGFGLIAHIEGEPSHKVV
RTAIHALARMQHRGAILADGKTGDGCGLLLQKPDRFFRIVAQERGWRLAKNYAVGMLFLN
KDPELAAAARRIVEEELQRETLSIVGWRDVPTNEGVLGEIALSSLPRIEQIFVNAPAGWR
PRDMERRLFIARRRIEKRLEADKDFYVCSLSNLVNIYKGLCMPADLPRFYLDLADLRLES
AICLFHQRFSTNTVPRWPLAQPFRYLAHNGEINTITGNRQWARARTYKFQTPLIPDLHDA
APFVNETGSDSSSMDNMLELLLAGGMDIIRAMRLLVPPAWQNNPDMDPELRAFFDFNSMH
MEPWDGPAGIVMSDGRFAACNLDRNGLRPARYVITKDKLITCASEVGIWDYQPDEVVEKG
RVGPGELMVIDTRSGRILHSAETDDDLKSRHPYKEWMEKNVRRLVPFEDLPDEEVGSREL
DDDTLASYQKQFNYSAEELDSVIRVLGENGQEAVGSMGDDTPFAVLSSQPRIIYDYFRQQ
FAQVTNPPIDPLREAHVMSLATSIGREMNVFCEAEGQAHRLSFKSPILLYSDFKQLTTMK
EEHYRADTLDITFDVTKTTLEATVKELCDKAEKMVRSGTVLLVLSDRNIAKDRLPVPAPM
AVGAIQTRLVDQSLRCDANIIVETASARDPHHFAVLLGFGATAIYPYLAYETLGRLVDTH
AIAKDYRTVMLNYRNGINKGLYKIMSKMGISTIASYRCSKLFEAVGLHDDVVGLCFQGAV
SRIGGASFEDFQQDLLNLSKRAWLARKPISQGGLLKYVHGGEYHAYNPDVVRTLQQAVQS
GEYSDYQEYAKLVNERPATTLRDLLAITPGENAVNIADVEPASELFKRFDTAAMSIGALS
PEAHEALAEAMNSIGGNSNSGEGGEDPARYGTNKVSRIKQVASGRFGVTPAYLVNADVIQ
IKVAQGAKPGEGGQLPGDKVTPYIAKLRYSVPGVTLISPPPHHDIYSIEDLAQLIFDLKQ
VNPKAMISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGTGASPLSSVKYAGCPWELGL
VETQQALVANGLRHKIRLQVDGGLKTGVDIIKAAILGAESFGFGTGPMVALGCKYLRICH
LNNCATGVATQDDKLRKNHYHGLPFKVTNYFEFIARETRELMAQLGVTRLVDLIGRTDLL
KELDGFTAKQQKLALSKLLETAEPHPGKALYCTENNPPFDNGLLNAQLLQQAKPFVDERQ
SKTFWFDIRNTDRSVGASLSGYIAQTHGDQGLAADPIKAYFNGTAGQSFGVWNAGGVELY
LTGDANDYVGKGMAGGLIAIRPPVGSAFRSHEASIIGNTCLYGATGGRLYAAGRAGERFG
VRNSGAITVVEGIGDNGCEYMTGGIVCILGKTGVNFGAGMTGGFAYVLDESGDFRKRVNP
ELVEVLNVDDLAIHEEHLRGLITEHVQHTGSQRGEEILANWSTFATKFALVKPKSSDVKA
LLGHRSRSAAELRVQAQ
NT seq 4554 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcaacccccgtcgccacgctctttctgtgcccgtgcgcagcggttcggaagtg
gggttcccgcagagcctgggggaggttcacgatatgttgtacgataaatcccttgagagg
gataactgtggtttcggcctgatcgcccacatagaaggcgaacctagccacaaggtagtg
cgtactgcaatacacgcactggcccgcatgcagcaccgtggcgcgattctcgccgatggt
aaaaccggtgacggttgcggcttgctgttacaaaaaccggatcgcttttttcgcatcgtt
gcgcaggagcgcggctggcgtttagcaaaaaactacgctgtcgggatgctcttcctgaat
aaagatcctgaactcgcggctgccgcacgccgcatcgttgaagaagagctgcaacgcgaa
accttgtcgattgtgggctggcgtgatgtccccactaacgaaggcgtgctgggtgaaatc
gccctctcctctctgccccgcattgagcaaattttcgttaacgctccggcaggctggcgt
ccgcgggatatggagcgccgtctgtttatcgcccgccgccgcattgaaaagcgtctcgaa
gccgacaaagacttctacgtctgtagcctgtcgaatctggtgaacatctataaaggtctg
tgtatgccggcggatctgccgcgcttttatctggatcttgcggacctgcgtctggaatcg
gccatctgcctgttccaccagcgcttctccactaacaccgtaccgcgctggccgctggcg
cagccgttccgctacctggcgcataacggtgaaatcaacaccatcaccggtaaccgccaa
tgggcgcgtgcgcgtacctataaattccagacgccgcttatccctgatctgcacgacgcc
gcaccgttcgtcaacgaaaccggctctgactccagttcgatggataacatgctggaactg
ctgctggcaggcgggatggatatcatccgcgccatgcgtctgttagtgccacccgcctgg
cagaacaacccggatatggacccggaactgcgtgccttctttgactttaactccatgcat
atggagccgtgggatggcccggcgggcatcgtgatgtccgacggtcgttttgccgcctgt
aacctcgaccgtaacggtctgcgtccggcgcgctacgtcatcaccaaagataagctcatc
acctgcgcctctgaagtcggtatctgggattaccagcctgacgaagtggtcgaaaaaggc
cgcgtcgggccaggcgaactgatggttatcgacacccgcagtgggcgtattctgcactcg
gcagaaaccgatgacgatctgaaaagccgccatccatataaagagtggatggagaaaaac
gtccgccgactggtaccgtttgaagatctgcccgatgaagaagtgggtagccgcgaattg
gacgacgacacgcttgccagctaccagaaacagtttaactacagtgcggaagagctggac
tccgtaattcgcgtactgggcgaaaacggtcaggaagcggtcggttcgatgggcgatgat
accccattcgccgtgctctccagtcagccgcgcattatttacgactacttccgccagcag
tttgcccaggtgactaacccgccaatcgacccgctgcgtgaagcgcatgttatgtcgctc
gccaccagtatcggtcgtgaaatgaacgtcttttgcgaagcagagggccaggcgcaccgt
ttaagctttaaatcgccgattctgctctactccgatttcaaacagctcacgacgatgaaa
gaggagcactaccgcgcagatacgctggatatcacctttgacgtcactaaaaccacgctc
gaagcgacagtcaaagagctgtgcgacaaagccgaaaaaatggtacgtagcggcaccgtg
ctgctggtgctctccgaccggaatatcgctaaagatcgcctgccggttccagccccgatg
gcggttggcgcgatccagacccgtctggtcgatcaaagcctgcgttgcgatgccaacatc
atcgtcgaaaccgccagcgcccgcgatccgcaccacttcgccgtgttgctgggcttcggc
gcgacggctatttatccataccttgcctatgaaacgctgggccgcctggtagacacccat
gcgattgccaaagattatcgtaccgtgatgctcaactaccgtaacggcatcaacaaaggc
ttgtacaaaatcatgtccaaaatgggcatctccaccatcgcctcttaccgctgctcgaaa
ctgtttgaagcggtcggtctgcacgatgatgtagtgggcctgtgcttccagggggcggtc
agccgcattggtggggcgagctttgaagacttccagcaggatctgctgaacctgtcgaaa
cgtgcctggctggcgcgtaagcccatcagccagggcggcctgctgaaatacgtccacggc
ggcgaataccacgcttacaacccggacgtggtgcgcacgctgcaacaggcggtacaaagc
ggcgagtacagcgactatcaggaatacgcgaagctggttaatgagcgtccggcaaccacg
ctgcgcgatctgctggcaattacgccgggtgaaaacgcggtcaacattgctgatgttgaa
ccggcaagcgaactgtttaaacgctttgataccgccgcgatgtctatcggcgcgttaagc
ccggaagcccacgaggcgctggcggaagcgatgaatagcatcggcggtaactcgaactcc
ggtgaaggcggcgaagacccggcgcgctatggcactaacaaagtgtcgcgcatcaagcag
gtggcttctggtcgcttcggcgttactccggcgtatctggtcaatgccgacgtcattcag
attaaagtcgcccagggcgcgaagccgggcgaaggcggtcagttgccgggcgacaaagtc
actccttacatcgccaaactgcgctattcggtgcccggagtgacgctgatctccccgccg
ccgcaccacgatatctactctatcgaggacttagcgcagctcattttcgacctcaagcag
gttaacccgaaagcgatgatctccgtgaagctggtttccgaaccgggcgtaggcaccatc
gcgactggcgtggcaaaagcttatgccgatttaatcaccatcgcaggctatgacggtggc
accggcgcaagcccgctgtcgtcagtgaaatacgcaggttgcccgtgggagctggggctt
gttgaaacccagcaggcgctggttgccaatggtctgcgtcataagatccgtttgcaggtc
gatggcggcctgaaaaccggtgttgatatcatcaaagcggcgattctcggcgcagaaagc
ttcggcttcggcactggcccaatggtcgcgctcggctgtaaatatctgcgtatttgccac
ctgaacaactgcgcaacgggtgtggcaactcaggatgacaaactgcgtaagaatcactat
cacggcctgccgttcaaggtgacgaattactttgagtttatcgcccgtgaaacccgcgag
ctgatggcacagctgggggtaacgcggctggtggatctgattggtcgcaccgacctgctg
aaagagctggacggtttcaccgccaaacagcagaaactggcgctgtcgaagctgctggag
accgccgaaccgcatccaggtaaggcactctactgcaccgaaaacaacccgccgtttgat
aacggcctgctgaacgcgcagttgctgcaacaggcgaaaccgtttgtcgatgaacgccag
agcaaaaccttctggttcgatatccgcaataccgatcgctccgtgggcgcgtcgctttca
ggctatatcgcccagacgcacggcgatcaggggctggcagccgatcctatcaaagcgtac
ttcaacggcaccgcaggccagagtttcggtgtatggaacgcgggcggcgtggaactgtac
ctgaccggggatgccaacgactatgtcggtaaaggcatggcgggcggcttaatcgccatt
cgtcctccggttggttccgccttccgcagccatgaagcaagtattatcggcaacacctgc
ctgtatggcgcgaccggtggtcgtctgtatgccgcaggccgcgcgggtgaacgtttcggc
gtgcggaactccggtgctatcaccgtggtagaaggcattggcgacaacggctgtgaatat
atgacgggcggtattgtctgtattctgggtaaaaccggcgttaacttcggtgcgggcatg
accggcggcttcgcttacgttctcgatgaaagcggtgatttccgcaaacgcgttaacccg
gaactggtcgaggtcttaaacgttgacgatctggcgatccatgaagagcatctgcgcggt
cttatcaccgagcatgttcagcatactggctctcagcgcggtgaagagattctggcgaac
tggtcaaccttcgccactaaatttgcgctggttaaaccgaagtccagtgatgtaaaagca
ctgctgggtcaccgtagtcgtagcgcagcagagttgcgcgtgcaggcgcagtaa

DBGET integrated database retrieval system