KEGG   Shigella boydii Sb227: SBO_3193Help
Entry
SBO_3193          CDS       T00301                                 

Gene name
murA
Definition
(GenBank) UDP-N-glucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sbo  Shigella boydii Sb227
Pathway
sbo00520  Amino sugar and nucleotide sugar metabolism
sbo00550  Peptidoglycan biosynthesis
sbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SBO_3193 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SBO_3193 (murA)
Enzymes [BR:sbo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SBO_3193 (murA)
Peptidoglycan biosynthesis and degradation proteins [BR:sbo01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   SBO_3193 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase Phage_gp49_66
Motif
Other DBs
NCBI-ProteinID: ABB67692
ShiBASE_China: SBO3193
UniProt: Q31W66
Position
3198642..3199901
Genome map
AA seq 419 aa AA seqDB search
MDKFRVQGPTKLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDVDTSMKLLSQL
GAKVERNGSVHIDARDVNVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCTIGAR
PVDLHISGLEQLGATIKLEEGYVKASVDGRLKGAHIVMDKVSVGATVTIMCAATLAEGTT
IIENAAREPEIVDTANFLITLGAKISGQGTDRIVIEGVERLGGGVYRVLPDRIETGTFLV
AAAISRGKIICRNAQPDTLDAVLAKLRDAGADIEVGEDWISLDMHGKRPKAVNVRTAPHP
AFPTDMQAQFTLLNLVAEGTGFITETVFENRFMHVPELSRMGAHAEIESNTVICHGVEKL
SGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRALGANIKRVKGE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggataaatttcgtgttcaggggccaacgaagctccagggcgaagtcacaatttccggc
gctaaaaatgctgctctgcctatcctttttgccgctctactggcggaagaaccggtagag
atccagaacgtcccgaaactgaaagacgtcgatacatcaatgaagctgctaagtcagctg
ggtgcgaaagtagaacgtaatggttctgtgcatattgatgcccgcgacgttaatgtattc
tgcgcaccttacgatctggttaaaaccatgcgtgcttctatctgggcactggggccgctg
gtagcgcgctttggtcaggggcaagtttcactgcctggcggttgtacgatcggtgcgcgt
ccggttgatctacacatttctggcctcgaacaattaggcgcgaccatcaaactggaagaa
ggttacgttaaagcttccgtcgatggtcgtctgaaaggcgcacatatcgtgatggataaa
gtcagcgttggcgcaacggtgaccatcatgtgtgctgcaaccctggcggaaggtaccacg
attattgaaaacgcagcgcgtgaaccggaaatcgtcgataccgcgaacttcctgattacg
ctgggtgcgaaaattagcggtcagggcaccgatcgtatcgtcatcgaaggtgtggaacgt
ttaggcggcggtgtctatcgcgtgctaccggatcgtatcgaaaccggtactttcctggtg
gcggcggcgatttctcgcggcaaaattatctgccgtaacgcgcagccagatactctcgac
gccgtgctggcgaaactgcgtgacgctggagcggacatcgaagtcggcgaagactggatt
agcctggatatgcatggcaaacgtccgaaggctgttaacgtacgtaccgcgccgcatccg
gcattcccgaccgatatgcaggcccagttcacgctgttgaacctggtggcagaagggacc
ggattcatcaccgaaacggtctttgaaaaccgctttatgcatgtgccggagcttagccgt
atgggcgcgcatgccgaaatcgaaagcaataccgttatttgtcatggtgttgaaaaactt
tctggtgcacaggttatggcaaccgatctgcgtgcatcagcaagcctggtgctggctggc
tgtattgcggaagggacgacggtggttgatcgtatttatcacatcgatcgtggctacgaa
cgcattgaagacaaactgcgcgctttaggtgcaaatattaagcgtgtgaaaggcgagtaa

DBGET integrated database retrieval system