KEGG   Shigella boydii Sb227: SBO_3517Help
Entry
SBO_3517          CDS       T00301                                 

Gene name
yhjA
Definition
cytochrome C peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sbo  Shigella boydii Sb227
Brite
Enzymes [BR:sbo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     SBO_3517 (yhjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
complement(3513357..3514754)
Genome map
AA seq 465 aa AA seqDB search
MKMVSRITAIGLAGVAICYLGLSGYVWYHDNKRSKQADVQASAVSENNKVLGFFREKGCD
YCHTPSAELPAYYYIPGAKQLMDYDIKLGYKSFNLEAVRAALLADKPVSQSDLNKIEWVM
QYETMPPTRYTALHWAGKVSDEERAEILAWIAKQRAEYYASNDTAPEHRNEPVQPIPQKL
PTDAQKVALGFALYHDPRLSADSTISCAHCHALNAGGVDGRKTSIGVGGAVGPINAPTVF
NSVFNVEQFWDGRAATLQDQAGGPPLNPIEMASKSWDEIIAKLEKDPQLKAQFLEVYPQG
FSGENITDAIAEFEKTLITPDSPFDKWLRGDENALTAQQKKGYQLFKDNKCATCHGGIIL
GGRSFEPLGLKKDFNFGEITAADIGRMNVTKEERDKLRQKVPGLRNVALTAPYFHRGDVP
TLDGAVKLMLRYQVGKELPQEDVDDIVAFLHSLNGVYTPYMQDKQ
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggtctcacgtattaccgcgatcggcctggctggcgtcgcgatttgctattta
gggttatctggttatgtgtggtaccacgataataaacgcagtaaacaggccgatgttcag
gcatctgctgtcagtgaaaataataaggttttaggctttttccgcgaaaaaggatgcgac
tattgccacacgccttcggcagaattacccgcctattattatattcctggcgcgaaacag
ttgatggattacgacattaagcttggatataaatcttttaacctcgaggccgtgcgtgcg
gcactgctggctgataaacccgtttcgcaaagcgatctgaataagattgaatgggtgatg
cagtatgaaactatgccaccaacgcgttataccgcgctacactgggcgggtaaggtgagt
gatgaagagcgggcggaaatactggcctggattgcaaaacagcgcgcggaatattacgcc
agcaatgatactgctccggagcatcgcaatgaaccggtgcagcccatcccgcaaaaactg
cctaccgatgcgcaaaaagtggcgttgggctttgcgctgtatcacgatccccgtttatcg
gctgatagcaccatttcatgcgctcattgccatgcgttgaatgcggggggcgtcgatggc
agaaaaacatcgattggtgttggtggcgcagttgggccgattaacgcgccgacggtattt
aactcagtatttaacgttgagcagttctgggatggtcgtgcggcaacattgcaggatcag
gcaggtggaccgccgttgaacccgattgaaatggcgtcgaaatcctgggacgaaattatt
gctaagctggaaaaagatccgcagcttaaagcgcagttcctcgaagtttatccgcaaggt
ttcagtggcgaaaatattactgatgccattgctgaatttgagaaaacattaattacgccg
gattccccatttgataaatggttgcgtggagatgaaaatgcgctgacggcgcaacagaaa
aaaggctatcaattatttaaagataataaatgtgcaacttgtcatggtggtattattctc
ggcggacgttcctttgaaccgttggggctgaaaaaagactttaactttggggaaattacg
gcggcggatattggtcgtatgaatgtgactaaagaagagcgtgataaattgcgccagaaa
gtacccggtttacgtaacgttgctttaacggcaccgtacttccatcgcggtgacgtgccg
acgctggacggggcggtgaaactgatgctgcgctatcaggtaggcaaagagctgccgcag
gaggatgtggatgatatcgtagctttcctgcacagtctgaacggggtgtacacgccgtat
atgcaggataaacaataa

DBGET integrated database retrieval system