KEGG   Shigella boydii Sb227: SBO_3530Help
Entry
SBO_3530          CDS       T00301                                 

Gene name
yhjM
Definition
(GenBank) putative endoglucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
sbo  Shigella boydii Sb227
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
ShiBASE_China: 
UniProt: 
Position
complement(3534772..3535878)
Genome map
AA seq 368 aa AA seqDB search
MNVLRSGIVTMLLLAAFSVQAACTWPAWEQFKKDYISQEGSVIDPSDARKITTSEGQSYG
MFFALAANDRAAFDNILDWTQNNLAQGSLKERLPAWLWGKKENSKWEVLDSNSASDGDVW
MAWSLLEAGRLWKEQRYTDIGSALLKRIAREEVVTVPGLGSMLLPGKVGFAEDNSWRFNP
SYLPPTLAQYFTRFGAPWTTLRETNQRLLLETAPKGFSPDWVRYEKDKGWQLKAEKTLIS
SYDAIRVYMWVGMMPDSDPQKARMLNRFKPMATFTEKNGYPPEKVDVATGKAQGKGPVGF
SAAMLPFLQNRDAQAVQRQRVADNFPGSDAYYNYVLTLFGQGWDQHRFRFSTKGELLPDW
GQECANSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgttgcgtagtggaatcgtgacgatgctgttgttggctgcctttagtgttcag
gcagcctgtacctggcctgcctgggagcagtttaaaaaggattacatcagtcaggaaggg
agcgtcatcgaccccagcgacgcgcgcaaaatcaccacctccgaagggcaaagttacggt
atgttctttgccctggcggctaacgaccgtgcagctttcgataatattctcgactggacg
cagaacaatctcgctcagggttctttaaaagaacgtttgcccgcctggctgtggggcaag
aaagagaacagtaagtgggaagtgctggacagcaattcggcctccgatggtgatgtctgg
atggcctggtcgttgctggaggcggggcgtttgtggaaagagcagcgttataccgacatc
ggcagcgcgttgctaaaacgtatcgcgcgggaggaagtggtgacggtgcctgggctgggt
tccatgttgttaccgggcaaagtgggttttgctgaggataacagctggcgttttaacccc
agctacctgccgccgacgctggcgcagtatttcacccgctttggcgcgccgtggactacg
ctgcgcgaaaccaatcaacgtttattgctggaaaccgccccgaaaggcttttcgccagac
tgggtgcgttatgagaaagacaaaggctggcagctaaaagccgaaaaaacattgatcagc
agctacgacgccatccgcgtttacatgtgggtaggcatgatgcctgacagcgatccgcag
aaagcgcggatgctcaaccggtttaaaccgatggcgacattcactgagaaaaacggttat
ccgccggaaaaagtggatgtggctacggggaaagcgcagggtaaaggaccagtcggtttt
tctgccgccatgctgccctttttacaaaaccgcgatgcgcaggccgttcagcgtcagcgc
gtggccgataactttcccggcagcgatgcctattacaactatgtgctgaccctgtttgga
caaggctgggatcaacaccgtttccgcttctcgacaaaaggtgagttattacctgactgg
ggccaggaatgcgcaaattcacactaa

DBGET integrated database retrieval system