KEGG   Shigella boydii Sb227: SBO_3618Help
Entry
SBO_3618          CDS       T00301                                 

Gene name
yibO
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K15633  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
sbo  Shigella boydii Sb227
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBO_3618 (yibO)
   01230 Biosynthesis of amino acids
    SBO_3618 (yibO)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBO_3618 (yibO)
  Energy metabolism
   00680 Methane metabolism
    SBO_3618 (yibO)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBO_3618 (yibO)
Enzymes [BR:sbo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     SBO_3618 (yibO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
3634045..3635589
Genome map
AA seq 514 aa AA seqDB search
MSVSKKPMVLVILDGYGYREEQQDNAIFSAKTPVMDALWANRPHTLIDASGLEVGLPDRQ
MGNSEVGHVNLGAGRIVYQDLTRLDVEIKDRAFFANPVLTGAVDKAKNAGKAVHIMGLLS
AGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGR
VASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATV
IRAEGQPDAAMEDGDALIFMNFRADRAREITRAFVNADFDGFARKKVVNVDFVMLTEYAA
DIKTAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILI
NSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEA
LDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYVGDKNVKA
VAGGKLSDIAPTMLSLMGMEIPQEMTGKPLFIVE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttctaaaaaacctatggtactggtgattctggatggctatggctatcgtgaa
gaacagcaggataacgccatttttagtgctaaaaccccggtaatggatgcactgtgggcc
aatcgtccgcataccctgatcgacgcttccggtctggaagtcggtctgcctgaccgtcag
atgggtaactccgaagtaggccacgttaacctgggtgccggccgcatcgtgtatcaggac
ctgactcgtctggacgttgaaatcaaagatcgcgctttctttgctaatccagtgctgact
ggcgcggtagataaagcgaaaaacgcaggtaaagcagtacacattatgggtctgctctcc
gcaggcggcgtacacagccacgaagatcacatcatggcgatggtagaactggcagctgaa
cgcggcgcagaaaaaatctacctgcacgcattccttgacggtcgcgacaccccgccgcgc
agtgctgaatcctcgctgaaaaaatttgaagagaaatttgctgcgctgggtaaaggccgc
gtagcgtccatcattggtcgttactacgcgatggaccgcgataaccgttgggatcgcgtt
gaaaaagcctatgacctgctgactctggcgcagggtgagttccaggccgatactgccgtt
gctggtttgcaggcagcttatgctcgcgacgaaaacgacgagttcgtgaaagcgaccgtt
attcgtgcagaaggtcagccagatgcggcaatggaagacggcgatgcgctgattttcatg
aacttccgtgctgaccgcgcgcgcgaaatcactcgtgcattcgtaaacgcagatttcgac
ggcttcgcgcgtaagaaagtggttaacgtcgatttcgtgatgctgaccgaatacgccgct
gacatcaaaactgcggttgcttacccacccgcttccctggttaacaccttcggcgagtgg
atggcgaaaaacgacaaaactcagttgcgtatttccgaaaccgaaaaatatgcccacgtt
actttcttcttcaacggtggcgtagaagagtcattcaaaggcgaagatcgcattctgatc
aactcaccgaaagtggctacctacgatctgcaaccggaaatgagctccgcagagctgacc
gaaaaactggttgcggccatcaagagcggcaaatacgacaccattatctgtaactatccg
aacggcgacatggtaggtcacaccggggtgatggaagcggcggttaaagcggttgaagca
ctggatcactgcgtggaagaagtcgcgaaagcggttgagtccgtgggtggacaactgctg
atcaccgctgaccacggtaacgctgaacagatgcgcgatccggcaacgggtcaggcacac
acggcacacaccaacctgccagttccgctgatttacgttggtgataagaacgtgaaagcg
gttgcaggcggcaaactttctgacatcgcgccgaccatgttgtcgctgatgggtatggaa
atcccgcaagagatgactggtaagccgctgttcatcgtggaataa

DBGET integrated database retrieval system