KEGG   Shigella boydii Sb227: SBO_3618Help
Entry
SBO_3618          CDS       T00301                                 

Gene name
yibO
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K15633  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
sbo  Shigella boydii Sb227
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBO_3618 (yibO)
   01230 Biosynthesis of amino acids
    SBO_3618 (yibO)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBO_3618 (yibO)
  Energy metabolism
   00680 Methane metabolism
    SBO_3618 (yibO)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBO_3618 (yibO)
Enzymes [BR:sbo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     SBO_3618 (yibO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
3634045..3635589
Genome map
AA seq 514 aa AA seqDB search
MSVSKKPMVLVILDGYGYREEQQDNAIFSAKTPVMDALWANRPHTLIDASGLEVGLPDRQ
MGNSEVGHVNLGAGRIVYQDLTRLDVEIKDRAFFANPVLTGAVDKAKNAGKAVHIMGLLS
AGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGR
VASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATV
IRAEGQPDAAMEDGDALIFMNFRADRAREITRAFVNADFDGFARKKVVNVDFVMLTEYAA
DIKTAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILI
NSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEA
LDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYVGDKNVKA
VAGGKLSDIAPTMLSLMGMEIPQEMTGKPLFIVE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttctaaaaaacctatggtactggtgattctggatggctatggctatcgtgaa
gaacagcaggataacgccatttttagtgctaaaaccccggtaatggatgcactgtgggcc
aatcgtccgcataccctgatcgacgcttccggtctggaagtcggtctgcctgaccgtcag
atgggtaactccgaagtaggccacgttaacctgggtgccggccgcatcgtgtatcaggac
ctgactcgtctggacgttgaaatcaaagatcgcgctttctttgctaatccagtgctgact
ggcgcggtagataaagcgaaaaacgcaggtaaagcagtacacattatgggtctgctctcc
gcaggcggcgtacacagccacgaagatcacatcatggcgatggtagaactggcagctgaa
cgcggcgcagaaaaaatctacctgcacgcattccttgacggtcgcgacaccccgccgcgc
agtgctgaatcctcgctgaaaaaatttgaagagaaatttgctgcgctgggtaaaggccgc
gtagcgtccatcattggtcgttactacgcgatggaccgcgataaccgttgggatcgcgtt
gaaaaagcctatgacctgctgactctggcgcagggtgagttccaggccgatactgccgtt
gctggtttgcaggcagcttatgctcgcgacgaaaacgacgagttcgtgaaagcgaccgtt
attcgtgcagaaggtcagccagatgcggcaatggaagacggcgatgcgctgattttcatg
aacttccgtgctgaccgcgcgcgcgaaatcactcgtgcattcgtaaacgcagatttcgac
ggcttcgcgcgtaagaaagtggttaacgtcgatttcgtgatgctgaccgaatacgccgct
gacatcaaaactgcggttgcttacccacccgcttccctggttaacaccttcggcgagtgg
atggcgaaaaacgacaaaactcagttgcgtatttccgaaaccgaaaaatatgcccacgtt
actttcttcttcaacggtggcgtagaagagtcattcaaaggcgaagatcgcattctgatc
aactcaccgaaagtggctacctacgatctgcaaccggaaatgagctccgcagagctgacc
gaaaaactggttgcggccatcaagagcggcaaatacgacaccattatctgtaactatccg
aacggcgacatggtaggtcacaccggggtgatggaagcggcggttaaagcggttgaagca
ctggatcactgcgtggaagaagtcgcgaaagcggttgagtccgtgggtggacaactgctg
atcaccgctgaccacggtaacgctgaacagatgcgcgatccggcaacgggtcaggcacac
acggcacacaccaacctgccagttccgctgatttacgttggtgataagaacgtgaaagcg
gttgcaggcggcaaactttctgacatcgcgccgaccatgttgtcgctgatgggtatggaa
atcccgcaagagatgactggtaagccgctgttcatcgtggaataa

DBGET integrated database retrieval system