KEGG   Shigella boydii Sb227: SBO_3618Help
Entry
SBO_3618          CDS       T00301                                 

Gene name
yibO
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K15633  
2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
sbo  Shigella boydii Sb227
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:sbo01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbo01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sbo00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:sbo00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sbo00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
3634045..3635589
Genome map
AA seq 514 aa AA seqDB search
MSVSKKPMVLVILDGYGYREEQQDNAIFSAKTPVMDALWANRPHTLIDASGLEVGLPDRQ
MGNSEVGHVNLGAGRIVYQDLTRLDVEIKDRAFFANPVLTGAVDKAKNAGKAVHIMGLLS
AGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPRSAESSLKKFEEKFAALGKGR
VASIIGRYYAMDRDNRWDRVEKAYDLLTLAQGEFQADTAVAGLQAAYARDENDEFVKATV
IRAEGQPDAAMEDGDALIFMNFRADRAREITRAFVNADFDGFARKKVVNVDFVMLTEYAA
DIKTAVAYPPASLVNTFGEWMAKNDKTQLRISETEKYAHVTFFFNGGVEESFKGEDRILI
NSPKVATYDLQPEMSSAELTEKLVAAIKSGKYDTIICNYPNGDMVGHTGVMEAAVKAVEA
LDHCVEEVAKAVESVGGQLLITADHGNAEQMRDPATGQAHTAHTNLPVPLIYVGDKNVKA
VAGGKLSDIAPTMLSLMGMEIPQEMTGKPLFIVE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtttctaaaaaacctatggtactggtgattctggatggctatggctatcgtgaa
gaacagcaggataacgccatttttagtgctaaaaccccggtaatggatgcactgtgggcc
aatcgtccgcataccctgatcgacgcttccggtctggaagtcggtctgcctgaccgtcag
atgggtaactccgaagtaggccacgttaacctgggtgccggccgcatcgtgtatcaggac
ctgactcgtctggacgttgaaatcaaagatcgcgctttctttgctaatccagtgctgact
ggcgcggtagataaagcgaaaaacgcaggtaaagcagtacacattatgggtctgctctcc
gcaggcggcgtacacagccacgaagatcacatcatggcgatggtagaactggcagctgaa
cgcggcgcagaaaaaatctacctgcacgcattccttgacggtcgcgacaccccgccgcgc
agtgctgaatcctcgctgaaaaaatttgaagagaaatttgctgcgctgggtaaaggccgc
gtagcgtccatcattggtcgttactacgcgatggaccgcgataaccgttgggatcgcgtt
gaaaaagcctatgacctgctgactctggcgcagggtgagttccaggccgatactgccgtt
gctggtttgcaggcagcttatgctcgcgacgaaaacgacgagttcgtgaaagcgaccgtt
attcgtgcagaaggtcagccagatgcggcaatggaagacggcgatgcgctgattttcatg
aacttccgtgctgaccgcgcgcgcgaaatcactcgtgcattcgtaaacgcagatttcgac
ggcttcgcgcgtaagaaagtggttaacgtcgatttcgtgatgctgaccgaatacgccgct
gacatcaaaactgcggttgcttacccacccgcttccctggttaacaccttcggcgagtgg
atggcgaaaaacgacaaaactcagttgcgtatttccgaaaccgaaaaatatgcccacgtt
actttcttcttcaacggtggcgtagaagagtcattcaaaggcgaagatcgcattctgatc
aactcaccgaaagtggctacctacgatctgcaaccggaaatgagctccgcagagctgacc
gaaaaactggttgcggccatcaagagcggcaaatacgacaccattatctgtaactatccg
aacggcgacatggtaggtcacaccggggtgatggaagcggcggttaaagcggttgaagca
ctggatcactgcgtggaagaagtcgcgaaagcggttgagtccgtgggtggacaactgctg
atcaccgctgaccacggtaacgctgaacagatgcgcgatccggcaacgggtcaggcacac
acggcacacaccaacctgccagttccgctgatttacgttggtgataagaacgtgaaagcg
gttgcaggcggcaaactttctgacatcgcgccgaccatgttgtcgctgatgggtatggaa
atcccgcaagagatgactggtaagccgctgttcatcgtggaataa

DBGET integrated database retrieval system