KEGG   Shigella boydii Sb227: SBO_4034Help
Entry
SBO_4034          CDS       T00301                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sbo  Shigella boydii Sb227
Pathway
sbo00620  Pyruvate metabolism
sbo00630  Glyoxylate and dicarboxylate metabolism
sbo01100  Metabolic pathways
sbo01110  Biosynthesis of secondary metabolites
sbo01120  Microbial metabolism in diverse environments
sbo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbo00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SBO_4034 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SBO_4034 (aceB)
Enzymes [BR:sbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SBO_4034 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABB68470
ShiBASE_China: SBO4034
UniProt: Q31TY8
Position
4073479..4075080
Genome map
AA seq 533 aa AA seqDB search
MTEQATTTDELAFTRPYGEQEKQILTAEAVEFLTELVTHFTPQRNKLLAARIQQQQDIDN
GTLPDFISETASICDADWKIRGIPADLEDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYQALLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQA
VTMDKPFLNAYSRLLIKTCHKRGAFAMGGMAAFIPSKDEEHNNQVLNKVKADKSLEANNG
HDGTWIAHPGLADTAMAVFNDILGSRKNQLEVMREQDAPITADQLLAPCDGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKMLSNGKPVTKALFR
QMLGEEMKVIASELGEERFSQGRFGDAARLMEQITTSDELIDFLTLPGYCLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaggcaacaacaaccgatgaactggctttcacaaggccgtatggcgagcag
gagaagcaaattcttactgccgaagcggtagaatttctgactgagctggtgacgcatttt
acgccacaacgaaataaacttctggcagcgcgcattcagcagcagcaagatattgataac
ggaacgttgcctgattttatttcggaaacagcttccatttgcgatgctgattggaaaatt
cgcgggattcctgcggacttagaagaccgccgcgtagagataactggcccggtagagcgc
aagatggtgatcaacgcgctcaacgccaatgtgaaagtctttatggccgatttcgaagat
tcactggccccggactggaacaaagtgatcgacgggcaaattaacctgcgtgatgcagtt
aacggtaccatcagctataccaatgaagcaggcaaaatttaccagctcaagcccaatcca
gcggttttgatttgtcgggtacgcggtctgcacttgccggaaaaacatgtcacctggcgt
ggtgaggcaatccccggcagcctgtttgattttgcgctctatttcttccacaactatcag
gctctgttggcaaagggcagtggtccctatttctatctgccgaaaacccagtcctggcag
gaagcggcctggtggagcgaagtcttcagctatgcagaagatcgctttaatctgccgcgc
ggcaccatcaaggcgacgttgctgattgaaacgctgcccgccgtgttccagatggatgaa
atccttcacgcgctgcgtgaccatattgttggtctgaactgcggtcgttgggattacatc
ttcagctatatcaaaacgttgaaaaactatcccgatcgcgtcctgccagacagacaggca
gtgacgatggataaaccattcctgaatgcttactcacgcctgttgattaaaacctgccat
aaacgcggtgcttttgcgatgggcggcatggcggcgtttattccgagcaaagatgaagag
cacaataaccaggtgctcaacaaagtaaaagcggataaatcgctggaagccaataacggt
cacgatggcacatggatcgctcacccaggccttgcggatacggcaatggcggtattcaac
gacattctcggctcccgtaaaaatcagcttgaagtgatgcgcgaacaagacgcgccgatt
actgccgatcagctactggcaccttgtgacggtgaacgcaccgaagaaggtatgcgcgca
aatattcgcgtagccgtgcagtacatcgaagcgtggatctctggcaacggctgtgtgccg
atttatggcctgatggaagatgcggcgacggctgaaatttcccgtacctcaatctggcag
tggatccatcatcaaaaaatgttgagcaatggcaaaccggtaactaaagccttgttccgc
cagatgctgggcgaagagatgaaagtcattgccagcgaactgggcgaagaacgtttctcc
caggggcgttttggcgatgccgcacgcttgatggaacagatcaccacttccgatgagtta
attgatttcctgaccctgccaggctactgcctgttagcgtaa

DBGET integrated database retrieval system