KEGG   Shigella boydii Sb227: SBO_4181Help
Entry
SBO_4181          CDS       T00301                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sbo  Shigella boydii Sb227
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sbo00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sbo00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:sbo03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:sbo03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sbo03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
ShiBASE_China: 
UniProt: 
Position
4236039..4236482
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARP
AESFVPHNLAGEGPRGGAPVEIAWPQKRSSSPRDILISLRTSFADFATAFTEVVDFVPYE
DSLKQLARERYKAYRVAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgcgacgttctaccttctggacaatgacaccaccgtcgatggcttaagcgcc
gttgagcaactggtgtgtgaaattgccgcagaacgttggcgcagcggtaagcgcgtgctc
atcgcctgtgaagatgaaaagcaggcttaccggctggatgaagccctgtgggcgcgtccg
gcagaaagctttgttccgcataatttagcgggagaaggaccgcgcggcggtgcgccggtg
gagatcgcctggccgcaaaaacgcagcagcagcccgcgcgatatattgattagtctgcga
acaagctttgcagattttgccaccgctttcacagaagtggtagacttcgttccttatgaa
gattctctgaaacaactggcgcgcgaacgctataaagcctaccgcgtggctggtttcaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system