KEGG   Shewanella baltica OS223: Sbal223_0065Help
Entry
Sbal223_0065      CDS       T00803                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sbp  Shewanella baltica OS223
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbp00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(75680..77158)
Genome map
AA seq 492 aa AA seqDB search
MKNQVQLITYVDRITNAGLKELKALLDDELQGLFGGVHLLPFYFPIDGSDAGFDPIDHVQ
VDSRLGNWDDVKRIGDDYDIMADLIVNHMSAESPEFKDVLQHGKQSAYWDLFLTKDKVFP
EGLSEQDQAAIYRPRPGSCFSTYTLADGSTEEFWTTFTRNQIDIDVHSTAGKDYLNRVLA
RFDHSKVNLIRLDAAGYAIKKPGTSCFMIEESFEFVDKLAKQANALGMTTLAEIHSHHMT
QVEIAKRVDMVYDFALPPLILHTLFSQDCQALTHWLEMAPRNCITVLDTHDGIGIIDVGP
MDGLRGLLTENQIDNLVETIHGNSKGESLQATGAAASNVDLYQINCTYYDALGQNDLDYL
MARAIQFFAPGIPQVYYAGLLAIPNDMELLNNTHVGRDINRPYLNREKVQQAMQKPVVKA
LTQLIKLRNSSPAFDGRFTMASAERTLTLSWTAADSQASLTLDFANKDGQIILLDKQGKE
TQVSLSKLLAQA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccaagtgcaactgatcacctatgtcgacagaattaccaatgcagggctcaag
gagctcaaagcgctactcgatgacgagttgcaaggtctattcggcggcgtacatcttttg
cctttctatttccccattgacggcagcgatgcgggcttcgatccgatagaccatgtgcaa
gtcgattcacgcttaggcaattgggatgacgttaaacgcattggtgatgactacgacatc
atggccgaccttatcgttaaccatatgtccgccgagtcacccgaatttaaagacgtgctc
cagcatggcaaacaatcggcttattgggatttgtttttaaccaaagacaaggtatttcct
gaggggttaagcgagcaagatcaagccgctatctatcgtccgcgtccgggaagttgtttt
agcacttacaccttagccgatggctcgaccgaagagttttggaccacctttacccgcaat
caaatcgatatcgacgttcattccaccgcgggtaaagactatttaaaccgagtgctggcg
cgtttcgatcacagtaaagtgaatctgatccgcttagatgcggcgggttatgcaattaaa
aagcccggcactagctgctttatgattgaagagtccttcgagttcgtggataagttagct
aagcaagccaatgcgttaggcatgacaacgctggccgaaatacattcgcaccacatgact
caggtcgaaatcgctaagcgggtcgacatggtgtacgacttcgccctgccaccgctcatc
ttgcacacgctgtttagccaagattgccaagccttgacccattggctggaaatggctcca
cgcaactgcattaccgtactcgacacccacgacggcatcggcattatcgacgtcggccct
atggatggcttgcgcggattattgaccgaaaatcaaatcgataatctggttgaaaccata
catggcaacagtaagggcgagagtctacaagccacaggcgcggccgccagcaacgtcgat
ttgtatcaaatcaactgcacctattacgatgccctcggtcagaatgacctagattatttg
atggcacgggcgattcaatttttcgcaccgggtattccgcaggtgtattacgcgggtctg
ctggcgattccaaacgatatggagctgctcaacaacacccatgtcggtcgcgatatcaat
cgcccttacttgaaccgtgaaaaagtgcagcaagccatgcagaaacctgtcgttaaggcg
ctgactcagctgattaaactgcgtaatagcagcccagccttcgatggccgctttacgatg
gcatcagcagaacgcacgttaaccttatcttggacagcggccgattcgcaggcgagcctc
accctcgactttgccaataaagatggccaaatcatccttttagataagcaaggtaaagag
acacaagtgtcgttatcaaaactgctggctcaagcataa

DBGET integrated database retrieval system