KEGG   Shewanella baltica OS223: Sbal223_0416Help
Entry
Sbal223_0416      CDS       T00803                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sbp  Shewanella baltica OS223
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sbp00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
464990..466474
Genome map
AA seq 494 aa AA seqDB search
MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWVEHDPMEIWASQSSVL
VEVLARAGIHSDEVAAIGITNQRETTVIWEKATGKPIYNAIVWQCRRSSEICEQLKAQGL
EEYVRENTGLLLDPYFSGTKIKWILDNVPNARAQAERGELLFGTIDTWLVWKLTEGKVHV
TDPTNAARTMLFNIHSLTWDNKLLEALDIPLSLLPEVKPSCSVYGTTRIAGEGSEIQVAG
MAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGTKAVRSNHGLLTTVAVGPKGEVNYA
LEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNGVYLVPAFVGLGAPYWDPNAR
GALFGLTRGANRNHIIRAALESIAYQSKDLLDAMTKDSGVSLKRLKVDGGAVANDFLMQF
QADITDVEVLRPSVCETTALGAAFLAGLAVGFWESVIELEHKACIDKHFIPNIDAENRGR
LYAGWQDAVARTRA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaaaatacgtggtggccttagatcaaggcacgaccagctcaagggcgatagtg
ttcgatcacgacgcaaacattgtcagcgtgtcccagcgggaattcacccagttgtatcca
aatccgggttgggtcgagcatgatcccatggagatctgggcaagccaaagttcagtgtta
gttgaagtgctggcgcgcgcggggatccacagcgatgaagtggccgcgattggcattact
aatcagcgggaaaccactgtcatttgggagaaagccacaggtaaacctatctataacgcg
attgtgtggcagtgccgtcgtagctctgaaatttgtgagcaactcaaagctcaagggcta
gaagagtatgtgcgtgaaaacacaggtctattactcgacccttatttttcaggcactaag
atcaagtggattctagataatgtgcccaatgcccgtgcgcaagctgaacgcggtgagttg
ttgttcggcactatcgatacttggctagtgtggaagttaaccgagggcaaagtgcatgtc
accgatcccaccaatgccgcccgtactatgctgtttaatatccatagcctgacttgggat
aacaagttacttgaagctttagacattcccttgtctttgttgcccgaagtgaagccttcc
tgcagtgtgtatggcaccacgcggattgctggtgaaggcagtgaaattcaagtcgcaggg
atggcgggtgaccaacaagcggcgctttttggtcagctgtgtgtcgagcccggcatggcg
aagaatacctatggcactggctgttttttattgatgaataccgggaccaaagcggtgcgc
tctaaccatgggttactgaccacagttgccgtgggaccgaagggcgaagtgaactatgcc
ctcgaaggttcagtcttcatgggtggcgcgaccattcaatggctgcgggatgaacttggg
cttattcgtgacgccagtgatactgagtattttgcctctaaggttgctgataccaatggc
gtgtatttagtgcccgcttttgtgggactcggggcaccttattgggatcccaatgcccgt
ggcgcactctttggtttaacccgtggcgccaaccgtaatcatattattcgggcggcgtta
gaatccattgcttatcagagtaaagatttactcgatgccatgaccaaagacagtggtgtc
agccttaagcgtttaaaggtggatggcggcgcggtcgccaatgattttttgatgcagttt
caagccgatatcaccgatgtcgaagtactaaggccgagtgtttgtgagacaacggctttg
ggcgcggcatttttagctgggttggctgtgggcttttgggagagtgtcattgagcttgaa
cataaggcttgtatcgataagcattttatccccaatattgatgccgagaatcgggggcgg
ttatacgcaggttggcaggatgccgtcgccagaactcgcgcctaa

DBGET integrated database retrieval system