KEGG   Shewanella baltica OS223: Sbal223_0422Help
Entry
Sbal223_0422      CDS       T00803                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sbp  Shewanella baltica OS223
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sbp00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sbp00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
471228..472727
Genome map
AA seq 499 aa AA seqDB search
MMLLRDLLAPWLHYAGAQSFNDLTLDSRAIRRGDVFLALPGHKVDGRQFIEKALDLGAAA
VLVHTDDADQHGKVLHRDNAEHGVQIYVFQLSRQVSAIAAQRYPLAHQSATTSLGVIGIT
GTNGKTSTSQLIAQLITSLGRKAAVMGTLGNGLWGELVDSGNTTADAITLMRQLHDFEAQ
GASVCAMEVSSHGLVQGRVDAVPFDVAVFTNLTRDHLDYHGDMESYAAAKQSLFRFSTLG
HGLLNLDDTVGESWLTELKSVPAQMWGFSIEGHQAAAFYTKDAKFDDQGVSATLVWPEGE
TEIHSPLLGAFNLSNLLAALSALYLQGFDMKALAEQVQYLTPVAGRMERFTTAKNITLVV
DYAHTPDAIEQALNALRRHCVGDLWCVFGCGGDRDKGKRPLMGQAAEQYADRIMVTSDNA
RSEDPAQIITDIIQGLTHPQQALTQVDRIAAIKEVVALAKPGDVILLAGKGHETYQEAAG
VRHDYDERALARQLSEQSR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgatgttattacgggatctgctcgcgccttggctgcattatgccggcgcgcagtccttc
aacgatttgaccttagatagccgcgcaatacgtcgcggcgatgtgtttttggcgctgcca
ggacataaggttgatggcagacagtttattgaaaaagccttagatttaggtgccgcagcc
gtattagtccatacggatgatgctgatcagcatggcaaagtgttgcacagagataatgcc
gagcacggcgtgcagatttatgtcttccagttgagtcgccaagtatcagccatcgccgcc
cagcgttatcccttagcgcatcagtctgcgacaacatcccttggggtgattggtatcact
ggaaccaatggtaaaacgtcgacaagtcaattgattgcccagctgataacgtcgctcggc
cgcaaagccgccgtgatgggcacccttggcaatggtctctggggcgagcttgtcgatagc
ggcaataccacagccgatgcgattaccctaatgcgtcagttgcatgactttgaagcccaa
ggcgcgagtgtctgcgccatggaagtgtcgagccacggcttagtgcaaggccgcgtcgat
gcagtaccattcgatgttgccgtgtttaccaatctgacgcgcgatcacctcgattaccac
ggtgatatggaaagctatgccgccgctaagcaaagcctatttcgcttcagcactttaggt
cacggtttattgaatctcgacgacacggttggcgagtcttggttgactgaacttaaatct
gtgcctgcgcaaatgtggggctttagtattgaaggtcatcaagccgcggctttttatact
aaagatgccaagtttgacgatcaaggtgtcagtgcaaccttagtgtggcccgagggcgaa
actgaaattcactcaccactacttggtgcctttaatctctctaatttactcgcggcgctc
tcagccttgtatctgcaaggttttgatatgaaagcgttagccgagcaagtgcaataccta
acgcccgtcgcaggtcgtatggagcgtttcacaactgcgaagaacatcaccttagtggtc
gattatgcccatacgccagatgcgattgaacaagcgttaaatgcgctacgtcgacattgt
gtcggtgatttatggtgcgtatttggttgtggtggcgaccgcgataagggcaagcgtcct
ttgatgggccaagctgcagagcaatatgctgaccgcattatggtgacgagcgacaatgcg
cgcagtgaagaccccgcgcaaattattaccgatattatccaagggctaacccatcctcag
caggcattgactcaggttgaccgtatcgcagcaattaaagaggttgtggcattggcgaaa
cctggcgatgtgatcttgcttgcgggcaaaggccacgaaacttaccaagaggcggcaggt
gtgcgtcatgactatgatgaacgcgccctggcacgccagttatcggagcaatcaagatga

DBGET integrated database retrieval system