KEGG   Shewanella baltica OS223: Sbal223_0656Help
Entry
Sbal223_0656      CDS       T00803                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00010  Glycolysis / Gluconeogenesis
sbp00052  Galactose metabolism
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
sbp01130  Biosynthesis of antibiotics
Module
sbp_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal223_0656
   00052 Galactose metabolism
    Sbal223_0656
Enzymes [BR:sbp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sbal223_0656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ACK45176
JGI: Sbal2230656
UniProt: B8E9G1
Position
complement(793644..794678)
Genome map
AA seq 344 aa AA seqDB search
MVRFSVLDPWTDPRGGEIERVRIDNGILALEVISLGGIIRALWTPDKHGERANIVLGCDS
AEDYLTQSAHLGAIAGRFANRIANGKMHYQGQDYQLDVNQATNCLHGGREGFNRKNWHLG
QLPDGVRLTLMSPDGDMGFPGNCTVQLDYRLAGNNLYVEILASVDKACPVSLTQHSYFNL
DGSETNHEHLMQIDAKRYLTMNDVSVPTGIAETAGSIFDLSQPIRLGDKLHAAELASTRG
YDHCYMMNDPDGSLARFGCLSSPVSGRAMTVYTNQPSVQLYCANFLDGTVGRNQQVLNQH
HGVCLEPQMLPDSPNQGERFGDDVWLVPGKVYHHISRYQFDADA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtttcagtgttttggatccttggaccgatccccgcggcggcgaaatcgaacgg
gtgaggatcgacaatggcatactcgcattagaagtcatcagcttaggcggaattatccgt
gctctgtggaccccagataaacacggcgaacgtgccaatatcgtccttggttgcgacagc
gccgaagactacctgacgcaatcggctcacttaggcgccattgctggccgctttgcgaat
cgtatcgctaacggcaaaatgcactatcaaggccaagattatcaacttgatgtcaaccaa
gcgactaactgtttacacggcggccgtgaagggtttaatcgtaaaaactggcacttaggc
caactgcccgatggtgtgcgcttgaccttaatgagtccagacggcgacatgggtttcccc
ggtaattgcacggttcaactggattaccgcctcgcaggtaataatctctatgtggaaatt
ttagcctcggtggataaagcctgtcccgtgagcttaacccagcacagttatttcaacctc
gatggttcagagaccaatcacgagcatttgatgcaaatcgatgccaagcgttatctcacc
atgaatgatgtcagtgttcccactgggattgccgagactgcaggatcgattttcgacttg
agtcagccgatacgcttaggcgacaaactgcatgccgcagaattagcgagcacgcgcggt
tatgatcactgttatatgatgaatgaccccgacggttcactcgcccgctttggctgttta
agcagtcctgtgagtggccgcgctatgacggtttataccaatcaaccgagcgtgcagctc
tactgcgctaactttttagatggcactgtgggtcgcaatcaacaggtattaaatcaacat
catggcgtgtgtttagagccgcagatgctgccagactcaccgaatcaaggcgagcgcttt
ggtgatgatgtttggttagtgccaggcaaggtttatcaccacatcagccgatatcagttc
gatgccgatgcgtaa

DBGET integrated database retrieval system