KEGG   Shewanella baltica OS223: Sbal223_0656Help
Entry
Sbal223_0656      CDS       T00803                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sbp  Shewanella baltica OS223
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sbp00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sbp00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(793644..794678)
Genome map
AA seq 344 aa AA seqDB search
MVRFSVLDPWTDPRGGEIERVRIDNGILALEVISLGGIIRALWTPDKHGERANIVLGCDS
AEDYLTQSAHLGAIAGRFANRIANGKMHYQGQDYQLDVNQATNCLHGGREGFNRKNWHLG
QLPDGVRLTLMSPDGDMGFPGNCTVQLDYRLAGNNLYVEILASVDKACPVSLTQHSYFNL
DGSETNHEHLMQIDAKRYLTMNDVSVPTGIAETAGSIFDLSQPIRLGDKLHAAELASTRG
YDHCYMMNDPDGSLARFGCLSSPVSGRAMTVYTNQPSVQLYCANFLDGTVGRNQQVLNQH
HGVCLEPQMLPDSPNQGERFGDDVWLVPGKVYHHISRYQFDADA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtttcagtgttttggatccttggaccgatccccgcggcggcgaaatcgaacgg
gtgaggatcgacaatggcatactcgcattagaagtcatcagcttaggcggaattatccgt
gctctgtggaccccagataaacacggcgaacgtgccaatatcgtccttggttgcgacagc
gccgaagactacctgacgcaatcggctcacttaggcgccattgctggccgctttgcgaat
cgtatcgctaacggcaaaatgcactatcaaggccaagattatcaacttgatgtcaaccaa
gcgactaactgtttacacggcggccgtgaagggtttaatcgtaaaaactggcacttaggc
caactgcccgatggtgtgcgcttgaccttaatgagtccagacggcgacatgggtttcccc
ggtaattgcacggttcaactggattaccgcctcgcaggtaataatctctatgtggaaatt
ttagcctcggtggataaagcctgtcccgtgagcttaacccagcacagttatttcaacctc
gatggttcagagaccaatcacgagcatttgatgcaaatcgatgccaagcgttatctcacc
atgaatgatgtcagtgttcccactgggattgccgagactgcaggatcgattttcgacttg
agtcagccgatacgcttaggcgacaaactgcatgccgcagaattagcgagcacgcgcggt
tatgatcactgttatatgatgaatgaccccgacggttcactcgcccgctttggctgttta
agcagtcctgtgagtggccgcgctatgacggtttataccaatcaaccgagcgtgcagctc
tactgcgctaactttttagatggcactgtgggtcgcaatcaacaggtattaaatcaacat
catggcgtgtgtttagagccgcagatgctgccagactcaccgaatcaaggcgagcgcttt
ggtgatgatgtttggttagtgccaggcaaggtttatcaccacatcagccgatatcagttc
gatgccgatgcgtaa

DBGET integrated database retrieval system