KEGG   Shewanella baltica OS223: Sbal223_0719Help
Entry
Sbal223_0719      CDS       T00803                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sbp  Shewanella baltica OS223
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal223_0719
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sbal223_0719
Enzymes [BR:sbp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Sbal223_0719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
856948..858207
Genome map
AA seq 419 aa AA seqDB search
MDKLTIQASPPLAGDVIISGAKNAALPILMAGVLAETDFVVSNVPNLRDVTTSCKLLRCL
GAEVTELGDGQIRISTTNLNEFCAPYDLVKTMRASILILGPLLARYGTADVSLPGGCAIG
ARPVNLHLHGLEMMGAKIEVKEGYIKARVDGRLKGAHIFMDMVSVGATENLLMAAALADG
ETVIENAAREPEVIDLANCLIAMGAKITGVGSATLRIQGVERLQGCNYRVMPDRIETGSF
LVAAAVTRGRIRCLKADPASLESVIAKLEDAGAKITTGEDWIELDMQGKRPKAVNIKTAP
YPGFPTDMQAQFCVLNALAQGTATITETIFENRFMHVPELIRMGATMELEGNTCIIQGIE
SLSGAQVMATDLRASASLVIAGLVADGKTIVDRIYHLDRGYEHIENKFQGLGAQVVRTQ
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtggataaactaacaattcaggcaagccccccgcttgccggtgatgtgatcatttcaggt
gctaaaaatgcggctctgcctattctgatggcaggcgtattggccgaaaccgattttgtg
gtttctaacgtgccgaatcttcgcgatgtgactactagctgtaaattattacgctgcctt
ggtgctgaagtgactgagcttggcgacggacagatccgcatttcaaccactaatctgaat
gagttttgcgctccctacgatctcgtgaaaaccatgcgtgcttctatcttgatcttagga
ccgttattggcgcgttatggtaccgcagacgtgtcattgcctggcggctgtgctattggc
gcaagaccagttaacttgcacttacatggcctcgaaatgatgggtgccaagattgaagtg
aaagaaggctatattaaagcccgtgttgatggacgtcttaagggcgcacacattttcatg
gacatggtcagtgtcggcgcaactgaaaacttgctgatggctgcggcgttagccgatggc
gaaaccgtgattgaaaacgcggcgcgcgaacctgaagtgatcgatttggccaattgcttg
attgccatgggcgcaaaaatcaccggcgtaggcagtgcaaccttgcgtattcaaggggtt
gagcgtttacagggctgtaattaccgcgtgatgccagatcgtatcgaaaccggttccttc
ctggttgctgctgcggtaacccgtggccgtattcgttgcctaaaagccgatcctgcatca
cttgagtcagttatcgctaagcttgaagatgcgggcgctaagattacgacgggcgaagat
tggattgagcttgatatgcaaggtaagcgtccaaaggcggtcaatatcaagacggcacct
tatccaggtttcccaacggatatgcaggcgcagttctgtgtgctcaacgctttagcgcaa
ggtacggcaaccataactgagactatcttcgaaaatcgttttatgcatgtgcccgaactt
atccgtatgggcgcaaccatggagcttgaaggtaatacctgcatcatccaagggattgaa
tccttaagtggtgcgcaggtgatggcgacggatttacgtgcgtcagcgagtctagtgatt
gcgggcttagttgccgatggcaagacgattgtcgatcgtatctatcacttagaccgtggt
tacgagcatattgagaataagttccaaggtttaggcgcgcaggttgtgcgtactcagtaa

DBGET integrated database retrieval system