KEGG   Shewanella baltica OS223: Sbal223_0776Help
Entry
Sbal223_0776      CDS       T00803                                 

Definition
glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sbp  Shewanella baltica OS223
Brite
Enzymes [BR:sbp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Sbal223_0776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
903304..903828
Genome map
AA seq 174 aa AA seqDB search
MSLKQKLVALGLSSAVALAGANLIAPTEAPNGEPILHTYLDPVEVITACLGHTGPELEIN
QFFSEQQCIEMFAKDLGKADRQLRRLTYPVQLTEGEHAAYLSLIYNFGAGNFQTSTLRKL
LLRGERVAACHQLTEACGKKGCNGFVYARDIKLPGLVERRAKEQSICLKDLYVE
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgtcattaaagcaaaagctcgtagcactggggctttcttctgctgtcgcgctggctggg
gctaatttgatagctcccaccgaagcgccgaacggcgagcccattctgcacacctatctt
gatccggtggaagttatcacagcttgcttagggcacactggccccgagcttgagatcaac
cagttttttagcgagcagcaatgcattgaaatgttcgccaaggatttaggtaaagccgat
cgccagctgcggcggctaacgtatccggtgcaacttaccgaaggtgagcacgctgcttat
ctcagtctgatttataactttggtgcgggtaactttcaaacctccactttgcgcaaattg
ttactccgcggcgaacgggtggcagcgtgccaccaactcaccgaagcctgcggaaaaaag
ggctgtaatgggtttgtctatgcgcgtgacatcaagttacctggcttagtcgaacgccgc
gcaaaagagcaatcaatctgcttaaaggatttatatgtggaataa

DBGET integrated database retrieval system