KEGG   Shewanella baltica OS223: Sbal223_1071Help
Entry
Sbal223_1071      CDS       T00803                                 

Definition
family 2 glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sbp  Shewanella baltica OS223
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Sbal223_1071
  Lipid metabolism
   00600 Sphingolipid metabolism
    Sbal223_1071
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sbal223_1071
Enzymes [BR:sbp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Sbal223_1071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1261784..1264129
Genome map
AA seq 781 aa AA seqDB search
MYFKLLFAIALLCISSVQVQASPQAQTAIKLSFNEDWQFQKSPAHATAFQPEAKAWEKVS
LPHTPKLESLLVNDQWQGIALYQKQFNAPKSWQGQRLYLRFEGAMNHTKVWLNDKPVGEH
LGGYLPFSIDISAAVNYGADNQLRVALDNNDNPITGPKPLHLLDFNTYGGLYRDVNLFIK
APLHISDEMLTNLPNRGGLVISSKIDDKAKASVAVQADIRNQGSKAAQFTLKQVLEFDGK
VVATIAQSYTLAANSQQVFSQNLTVKQPKLWHPTHPNLYQLQTELWQGNTLLERSSNKVG
IREFAFNDKHELLINGEPYFLRGINRHQDYPHVGYATSKQADYRDAIKIKEAGFDYVRLS
HYPHSPAFMDAADEVGLVLIDAVLGWQYFSPEPEFAEHVYQSCRDLLHRDRNHASVLAWE
CSLNETPMPVAFIDNLKAIIQAELPGAMSAGWQTQYDIYLQARQHRMQHYQTPTQPYNVS
EYGDWEYYAQNAGLNQQAWADLKDDERTSRQLLGAGEKRLLQQAMNLQEAHNDNLHTPAF
ADGYWVMFDYNRGYANDLESSGIMSIYRQPKFSYYLFQSQRDPALTSTKYNAGPMVYIAS
DWQADSSPNVRVFSNADAVELWLNGKLITRQIPDNGANTDKLPHPPFTFHLPSFEAGELS
AKAFIGNQFVATHSVRTPQAIHALDISLDTAGVPINSAGSDVLFVNVRLVDANGTTVPVN
DKVVSFEVNGAIQVLNPDAIVTEKGVASALVRVHNGAKGAHLKASFAAENTAAPLTAELK
F
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgtatttcaagttgttgtttgcaatagcattgctgtgtatctccagcgtgcaagtgcag
gcttcgccacaggcgcagactgccatcaaactgtcgttcaacgaagattggcaattccaa
aagtcacccgcccacgctaccgcgtttcagcctgaggctaaagcatgggaaaaagtgagc
ttaccccatacaccaaagcttgaatccctactggtcaatgaccaatggcagggtattgcc
ctgtatcaaaagcaatttaatgctcctaaatcttggcaaggacagcggctttacctgcgt
tttgaaggtgcaatgaaccacaccaaagtttggttaaacgataaacctgtgggtgaacat
ttaggcggataccttcctttcagcatcgatatttcagctgcggttaattatggtgcggac
aaccagttacgggtggcgttagacaataacgacaatccaattaccggtcctaaaccacta
catttactcgactttaatacctatggtggtttgtaccgcgacgttaatttattcattaaa
gcaccgctgcacatcagcgatgagatgctgacgaatttaccgaaccgtggtggtttagtg
atttcgagcaagatcgacgataaggctaaggcgagtgtggccgttcaggccgatatccgt
aatcaaggcagtaaagcggctcagttcaccttaaaacaggtgcttgagttcgacggtaaa
gtggttgcaacaatagcgcaaagctacactttggcagctaatagccagcaagttttcagc
cagaacttaacggtaaaacagccaaagttatggcatccaacccatccgaatctttatcaa
ttgcagactgaactctggcaaggcaacaccttgctcgagcgaagcagtaataaggtcggt
atccgtgaatttgctttcaatgacaaacatgaattgttgattaacggtgaaccctatttc
ctgcgcggtataaatcgtcatcaagattatccccatgtcggttatgccacctcaaaacaa
gccgattaccgtgatgccatcaagatcaaagaagccggatttgattatgttcgcttatct
cactatccccattcgcccgcctttatggacgccgccgatgaagttgggctagtgctgatt
gatgccgtattaggttggcagtatttctcacctgagcctgagtttgctgagcatgtgtat
cagtcttgcagagatctactgcaccgcgatcgtaaccacgccagcgtgttagcgtgggaa
tgctcgctcaatgaaactccaatgccagtggcctttatcgacaacctgaaagccatcatt
caggcggaacttcctggtgcaatgtctgcaggttggcaaacgcaatacgatatctatctg
caagctcgtcaacatagaatgcagcattatcaaacaccgactcagccatacaatgtgtct
gaatacggtgattgggaatactacgcccaaaatgcaggcctaaaccaacaggcgtgggcc
gatcttaaggatgatgaacgcaccagtcggcagctactcggtgctggtgaaaagcgttta
ctacaacaggcaatgaacctacaggaagcccataacgataatttacacacgcccgcgttt
gccgacggttattgggtgatgtttgactataaccgtggctatgcgaatgacttagagtcc
tcgggcattatgagcatctatcgtcaacctaagttcagctattacctgttccaaagtcag
cgcgaccccgcgctaacgtcaaccaaatacaatgccggacctatggtgtatatcgcctca
gattggcaagcggactcttcgccaaatgttcgggtgttcagtaacgcggatgccgtcgag
ttatggctaaacggtaaattaattacccgtcaaatacccgataacggcgcgaataccgac
aagttgcctcatccaccttttactttccatctgcccagttttgaggcgggagagctaagt
gctaaagcctttattggcaatcagttcgtcgcgacgcacagcgttcgtactccccaagcg
attcatgcgcttgatatttcactcgataccgcaggtgtgccgattaattccgctggcagc
gatgtgctgtttgtgaatgtcagattggttgatgccaatggcaccacagtaccagtgaat
gacaaggtggtgagctttgaagtcaatggcgcgattcaagtgctcaatccggatgcgata
gtgacagaaaagggcgttgccagcgcattggtacgagtgcataacggtgcaaaaggcgcg
cacttaaaagcctcttttgcggcagaaaacacagctgcgccgttaactgctgagctgaaa
ttctaa

DBGET integrated database retrieval system