KEGG   Shewanella baltica OS223: Sbal223_1122Help
Entry
Sbal223_1122      CDS       T00803                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sbp  Shewanella baltica OS223
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal223_1122
Enzymes [BR:sbp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Sbal223_1122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1319562..1320416
Genome map
AA seq 284 aa AA seqDB search
MFELIAGTKRLALSSPIVMGILNVTPDSFSDGGQYSSYELACQHADDMVAQGAGMIDIGG
ESTRPGAAEVSLADELARVIPLVKYVAMHHDVWISVDTSKAEVMRQAVAAGAHLINDVRA
LMEPGALEAAAELHVPICLMHMQGEPKSMQSSPMYYDVIEEVSSFLTERIDACLQAGIPR
ELLILDPGFGFGKSLEHNYELLAKLDCFAKFDLPVLIGLSRKSMIGNLLAKPTSERLAGS
LAGAMIAAQKGAHIIRVHDVAETVDMLKVLQATQAYFEASLCSR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgaactgattgctggcactaaacgcctcgcgttatcttcgcccatagtgatgggc
attttgaatgtcactcccgattccttttccgacggtggtcaatattcttcctatgaactt
gcctgtcagcatgccgatgacatggtggctcaaggcgcagggatgattgatattggtgga
gagtcgacaaggcccggcgccgccgaggtgagcctagccgatgaacttgcgcgggtgatc
ccgttagtaaaatatgtggcgatgcaccatgatgtgtggatttcggtcgataccagtaaa
gctgaagtgatgcgccaagctgtcgctgcgggtgcacacctgattaatgatgtgcgtgcc
ttgatggaacccggtgcgctcgaagctgccgcagagttgcacgtcccgatatgcctaatg
catatgcagggtgagccgaagagcatgcagtcttcgccgatgtattatgatgttattgaa
gaagtttctagctttttaaccgaacggattgacgcttgcttacaagctgggatcccccgt
gaattactcatactcgatccgggatttggctttggtaaaagcttagaacataactatgaa
ttactggcaaagctcgactgttttgccaagtttgatttacccgtattgataggattgtct
cgtaagagcatgatagggaacctcttagcaaaaccgacctcagagcgtcttgctgggagc
cttgctggcgctatgatagcggcccaaaagggagctcatatcattcgcgtacatgatgtt
gctgaaactgtggatatgctcaaggtgttacaagcgacacaagcgtattttgaagcatcg
ttatgctctcgttaa

DBGET integrated database retrieval system