KEGG   Shewanella baltica OS223: Sbal223_1124Help
Entry
Sbal223_1124      CDS       T00803                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbp  Shewanella baltica OS223
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal223_1124
   01230 Biosynthesis of amino acids
    Sbal223_1124
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal223_1124
   00051 Fructose and mannose metabolism
    Sbal223_1124
   00562 Inositol phosphate metabolism
    Sbal223_1124
Enzymes [BR:sbp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sbal223_1124
Exosome [BR:sbp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sbal223_1124
  Exosomal proteins of bladder cancer cells
   Sbal223_1124
  Exosomal proteins of melanoma cells
   Sbal223_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1322008..1322790
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSSEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagtgcggcatta
gcccaagagttgttcaaaaaatttgcctctaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagagagcgttaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgcacaaaacctaagtcaacacgactttggc
gcctataccggagaagtttcaggtcagatgctcaaagattcaggatgtcgatatgtaatt
atcggacattcagaacgtcgccgtatgtacggagagacgagtaatatcgtagcggagaaa
ttcgccgctgcacaaaagcatggcttaactcccattttatgtgtgggtgagtcaggtcca
gcacgtgaagcaagacgcaccttcgaggtgattgcggaagagttggatatagtgatccag
aaaaacggcactatggcttttgataacgccattatcgcctacgagccactttgggctgta
gggacaggtaaaagcgctacaccagagcaggcacaagaagttcatgcgtttattcgcaaa
cgcctctctgaagtgtctccgtttatcggagaaaatatcaggattctctacggtggtagt
gtaacaccgagtaatgctgcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgctagcttaaactctagcgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system