KEGG   Shewanella baltica OS223: Sbal223_1124Help
Entry
Sbal223_1124      CDS       T00803                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00010  Glycolysis / Gluconeogenesis
sbp00051  Fructose and mannose metabolism
sbp00562  Inositol phosphate metabolism
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01120  Microbial metabolism in diverse environments
sbp01130  Biosynthesis of antibiotics
sbp01200  Carbon metabolism
sbp01230  Biosynthesis of amino acids
Module
sbp_M00002  Glycolysis, core module involving three-carbon compounds
sbp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal223_1124
   00051 Fructose and mannose metabolism
    Sbal223_1124
   00562 Inositol phosphate metabolism
    Sbal223_1124
Enzymes [BR:sbp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sbal223_1124
Exosome [BR:sbp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sbal223_1124
  Exosomal proteins of bladder cancer cells
   Sbal223_1124
  Exosomal proteins of melanoma cells
   Sbal223_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACK45639
JGI: Sbal2231124
UniProt: B8E6M8
Position
1322008..1322790
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSSEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagtgcggcatta
gcccaagagttgttcaaaaaatttgcctctaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagagagcgttaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgcacaaaacctaagtcaacacgactttggc
gcctataccggagaagtttcaggtcagatgctcaaagattcaggatgtcgatatgtaatt
atcggacattcagaacgtcgccgtatgtacggagagacgagtaatatcgtagcggagaaa
ttcgccgctgcacaaaagcatggcttaactcccattttatgtgtgggtgagtcaggtcca
gcacgtgaagcaagacgcaccttcgaggtgattgcggaagagttggatatagtgatccag
aaaaacggcactatggcttttgataacgccattatcgcctacgagccactttgggctgta
gggacaggtaaaagcgctacaccagagcaggcacaagaagttcatgcgtttattcgcaaa
cgcctctctgaagtgtctccgtttatcggagaaaatatcaggattctctacggtggtagt
gtaacaccgagtaatgctgcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgctagcttaaactctagcgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system