KEGG   Shewanella baltica OS223: Sbal223_1243Help
Entry
Sbal223_1243      CDS       T00803                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sbp  Shewanella baltica OS223
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1468619..1469254
Genome map
AA seq 211 aa AA seqDB search
MTRVALTSAVNLAKKLHDAGIRNQAVLKAISHTPREMFLDNALAHKAYENTALPIGQGQT
ISQPYIVARMTELLLHKMPQRVLEVGTGSGYQAAILAQLVPQLCTIERIKGLQIQARQRL
KRLDLHNVSFKYGDGWLGWANRSPFDAIMVTAAASTIPEALLSQLAEGGVLVLPVGEDTQ
QLMRITRTADRFSSETIETVKFVPLINGELA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgactcgagttgccttaacatcggcggtgaacttagctaaaaagcttcatgatgcgggg
atccgcaatcaagccgtgttaaaggcgatatcgcatacgccgcgggaaatgtttctcgat
aatgcgctagcccataaagcctatgaaaataccgctttaccgattggccaagggcaaacc
atctcacagccttatatcgtcgcccgtatgaccgaactcttactgcataagatgccccag
cgcgtattagaagtgggtacaggatcgggttatcaggcggcaattttggcgcaattagtg
ccgcagctttgtactatcgagcgaataaaaggcttacaaattcaagcgagacagcgctta
aaacgattagatttacataatgtgtcgtttaaatatggtgatggatggttaggttgggcg
aatcgtagcccgttcgatgccattatggtgaccgctgccgcttcgactatacctgaggcc
ttactgtctcaattagccgagggcggagtgttagttctgccagtcggcgaagatacccag
caattgatgcgaatcactcgtactgcggaccgcttcagttcggaaacaattgaaacggtt
aaatttgtccctttgattaatggagagttagcttaa

DBGET integrated database retrieval system