KEGG   Shewanella baltica OS223: Sbal223_1328Help
Entry
Sbal223_1328      CDS       T00803                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
sbp  Shewanella baltica OS223
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sbal223_1328
   00330 Arginine and proline metabolism
    Sbal223_1328
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Sbal223_1328
Enzymes [BR:sbp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Sbal223_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1560060..1560974
Genome map
AA seq 304 aa AA seqDB search
MPELALLEEVVDKVRPLLGQGKVADYIPALASVDAGKLGIAVTTVDGETLGAGDYLEPFS
IQSISKVFSLTLALTLYEEAEIWSRVGKEPSGHSFNSLVQVELERGKPRNPFINAGALVI
ADLLQSRLGAPKHRMLELVRQLSQNDKVCFDKQVADSEYQHSARNAAIAYLMKSFGNFQG
DVDTVLRTYFHYCALKMNCADLSKAMLYLANRGKSITGTELISQVQTRQLNALLATSGLY
DGAGEFAYRVGMPGKSGVGGGIIAVIPGELSICVWSPELDGNGNSLAGTAMLEHLSQRLG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagttggcattacttgaggaagtggtcgacaaagttcgacccttgctcggccaa
ggaaaggttgcagattatatccccgcactggctagcgtcgatgctggtaaattaggcatt
gccgtcacaaccgttgatggtgaaaccttaggtgcgggcgattaccttgagccgttttcg
attcaaagtatctccaaagttttcagcttaaccttagcgttaactttatatgaagaggcc
gaaatttggagccgagttggcaaagaaccttcgggccattcattcaactctttagtacaa
gtcgagttagaacgtggcaagccgcgtaatccatttatcaatgctggcgcgttagtgatt
gctgacttattgcagagtcgtttaggtgcacctaaacacagaatgctcgagttagtcagg
caactaagccaaaacgataaagtgtgtttcgacaaacaagtggccgactccgaatatcag
cacagtgcgcgcaatgcggcgattgcttatttgatgaagtcctttggtaattttcaaggc
gatgtcgatactgtgctgcgcacgtattttcattactgcgccttaaagatgaattgtgct
gacttgtctaaggccatgttgtacttggctaatcgcggcaaaagcattacggggactgag
cttatttctcaggtgcaaactcggcagcttaatgccctgttggcgacctcgggcctatac
gatggtgcaggtgagtttgcctatcgtgttggtatgccaggtaaaagtggtgtcggtggt
ggcatcattgccgttattcctggggaactgtcgatttgtgtttggtcgccagaactcgat
ggcaatggcaattcacttgctggcactgccatgcttgagcacttaagtcagcgtcttggc
cgatctattttctag

DBGET integrated database retrieval system