KEGG   Shewanella baltica OS223: Sbal223_1328Help
Entry
Sbal223_1328      CDS       T00803                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00220  Arginine biosynthesis
sbp00250  Alanine, aspartate and glutamate metabolism
sbp00471  D-Glutamine and D-glutamate metabolism
sbp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sbal223_1328
   00220 Arginine biosynthesis
    Sbal223_1328
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Sbal223_1328
Enzymes [BR:sbp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Sbal223_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ACK45836
JGI: Sbal2231328
UniProt: B8E920
Position
1560060..1560974
Genome map
AA seq 304 aa AA seqDB search
MPELALLEEVVDKVRPLLGQGKVADYIPALASVDAGKLGIAVTTVDGETLGAGDYLEPFS
IQSISKVFSLTLALTLYEEAEIWSRVGKEPSGHSFNSLVQVELERGKPRNPFINAGALVI
ADLLQSRLGAPKHRMLELVRQLSQNDKVCFDKQVADSEYQHSARNAAIAYLMKSFGNFQG
DVDTVLRTYFHYCALKMNCADLSKAMLYLANRGKSITGTELISQVQTRQLNALLATSGLY
DGAGEFAYRVGMPGKSGVGGGIIAVIPGELSICVWSPELDGNGNSLAGTAMLEHLSQRLG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagttggcattacttgaggaagtggtcgacaaagttcgacccttgctcggccaa
ggaaaggttgcagattatatccccgcactggctagcgtcgatgctggtaaattaggcatt
gccgtcacaaccgttgatggtgaaaccttaggtgcgggcgattaccttgagccgttttcg
attcaaagtatctccaaagttttcagcttaaccttagcgttaactttatatgaagaggcc
gaaatttggagccgagttggcaaagaaccttcgggccattcattcaactctttagtacaa
gtcgagttagaacgtggcaagccgcgtaatccatttatcaatgctggcgcgttagtgatt
gctgacttattgcagagtcgtttaggtgcacctaaacacagaatgctcgagttagtcagg
caactaagccaaaacgataaagtgtgtttcgacaaacaagtggccgactccgaatatcag
cacagtgcgcgcaatgcggcgattgcttatttgatgaagtcctttggtaattttcaaggc
gatgtcgatactgtgctgcgcacgtattttcattactgcgccttaaagatgaattgtgct
gacttgtctaaggccatgttgtacttggctaatcgcggcaaaagcattacggggactgag
cttatttctcaggtgcaaactcggcagcttaatgccctgttggcgacctcgggcctatac
gatggtgcaggtgagtttgcctatcgtgttggtatgccaggtaaaagtggtgtcggtggt
ggcatcattgccgttattcctggggaactgtcgatttgtgtttggtcgccagaactcgat
ggcaatggcaattcacttgctggcactgccatgcttgagcacttaagtcagcgtcttggc
cgatctattttctag

DBGET integrated database retrieval system