KEGG   Shewanella baltica OS223: Sbal223_1341Help
Entry
Sbal223_1341      CDS       T00803                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sbp  Shewanella baltica OS223
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Sbal223_1341
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sbal223_1341
Enzymes [BR:sbp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Sbal223_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1573544..1574083
Genome map
AA seq 179 aa AA seqDB search
MKKLPMIFAMTASLMSVGAMAATCPEYLNLEVRKLHSEETVNLCELTQGKPVLIVNTASN
CGYTPQFKALEALHENYKDKGLVVIGFPSDDFFQEENDEKDTAKVCYINYGVTFTMLSTS
AVRGSDANSVFKYLAEKTGAPKWNFYKYVVSGDGAVVQQFNSKVKPDSEELKRAIESVL
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattacctatgatattcgctatgactgcgagcttgatgagtgttggcgctatg
gcggccacttgtcccgagtatttgaaccttgaagtacgaaaattacattctgaagagaca
gttaatctgtgtgaattgactcagggaaagccagtgttgattgttaacactgcaagtaac
tgtggttacaccccgcagtttaaagcgctcgaagcattgcatgaaaactataaagacaaa
ggcttagtggttattggtttcccatcggatgattttttccaagaagaaaatgatgagaaa
gacacggctaaggtgtgttacatcaattacggtgtcactttcactatgttgtcgacttcg
gctgtgcgtggcagtgacgccaatagcgtatttaaatacttagccgaaaaaaccggtgcg
cctaagtggaatttttacaagtatgtcgttagcggcgatggcgcggttgtgcaacagttc
aattctaaagtgaagccagatagcgaagagcttaagcgagcaatagaatctgtactttaa

DBGET integrated database retrieval system