KEGG   Shewanella baltica OS223: Sbal223_1458Help
Entry
Sbal223_1458      CDS       T00803                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sbp  Shewanella baltica OS223
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sbp02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sbp02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1701183..1702310
Genome map
AA seq 375 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIVNQDPELEVIATASNGAEAVKMAAELNPQVITMDIEMPV
MDGITAVREIMAKCPTPILMFSSLTHDGAKATLDALDAGALDFLPKRFEDIATNKDDAIL
LLQQRVKALGRRRMFRPIARPVVASTPSVRPTSSVLGTTIIASHTPATAPVRTSTAASIR
ASGKQYKILLIGTSTGGPVALQKILTQFPANYPHPILLIQHMPAAFTPAFASRLNGLCKI
EVKEAANGDLLKPGCAYLAPGGMQMMVERTGGSGRLKVIAGSADMNYKPCVDITFASASK
AFSGDVLAVVLTGMGADGREGARMLKAVGATIWAQDEASCVVYGMPQAVASAGIATQSIA
LDNMAECILKESVRV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccattaaagtattagtcgttgatgactcaagttttttcagacgacgtgttagtgaa
atagtcaatcaagatcctgaactggaagttatcgcgacggcctcaaatggggccgaagcg
gtgaagatggctgctgagcttaatcctcaagttatcactatggatattgagatgcccgtg
atggatggcattactgccgtccgtgaaatcatggctaaatgtccgactccgatcttgatg
ttttcttctttaacccatgatggcgctaaagcaacgttagacgctttagatgctggtgcg
ttagattttctacctaaacgttttgaagacattgctaccaataaagatgatgctatttta
ttgttacagcagagagttaaggcattgggacgccgcagaatgtttcgtcctattgcacgt
cctgtcgtcgcttcaacacctagcgtgcgtccaacaagtagcgttttagggacaacgatt
atagcgtcgcatactccagccactgctcctgtgaggacctcaacagcagcgtcgattcgt
gcaagtggtaagcagtataaaatactgctgatcggcacatctactggtggtccagttgcc
ttgcaaaaaattcttacccaattcccggcaaactatccgcatccgattttattaattcag
catatgccagcagcttttacgccagcatttgcaagtcgtttgaatggcttatgtaagatt
gaagtaaaagaggccgctaatggcgatcttcttaaaccaggttgtgcgtatttagcgcct
ggcggtatgcaaatgatggttgaacgtactggaggtagtggtcgattaaaggtcatcgct
ggcagcgcggacatgaactataagccttgtgttgatatcacctttgcttctgcctctaaa
gcctttagtggtgatgtgcttgctgttgtattaactggtatgggcgcggatggcagagaa
ggtgcccgtatgttgaaagcggtcggtgcgaccatttgggcacaggatgaagccagttgt
gtggtttatggtatgcctcaggctgtcgctagtgcaggtattgccactcagtcgattgcc
ttagacaacatggctgaatgcattttaaaagagtctgttcgtgtctaa

DBGET integrated database retrieval system