KEGG   Shewanella baltica OS223: Sbal223_1659Help
Entry
Sbal223_1659      CDS       T00803                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sbp  Shewanella baltica OS223
Pathway
sbp00260  Glycine, serine and threonine metabolism
sbp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sbp01100  Metabolic pathways
sbp01110  Biosynthesis of secondary metabolites
sbp01130  Biosynthesis of antibiotics
sbp01230  Biosynthesis of amino acids
Module
sbp_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal223_1659
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal223_1659
Enzymes [BR:sbp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sbal223_1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: ACK46164
JGI: Sbal2231659
UniProt: B8EEF9
Position
complement(1939515..1940351)
Genome map
AA seq 278 aa AA seqDB search
MSDTLTNPGLYQAARYQATFAKLKAEGRGAFVPFVTLGDPSPELSLKIIDTLVQNGADAL
ELGFPFSDPLADGPVIQGANLRSLAAGTTPTACFELLAQVRAKYPELPIGLLLYANLVFA
NGIDAFYAKAQHAGVDSVLIADVPVEESAPFSEAAKAHGIAPIFIAPPNADTETLALVSA
SGEGYTYLLSRAGVTGTDTKAGVPVEEILFKLKTFNAPPPLLGFGIAEPAQVTAAIKAGA
AGAISGSAVVKIIENHQHDEAKLLATLGDFTRAMKAAT
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatacattgactaacccaggcctttaccaagcggcccgttaccaagccaccttt
gccaaactcaaagccgaaggccgtggtgcttttgtccccttcgtcacccttggcgaccct
agccctgagttatcgctgaaaattatcgataccttagtgcaaaacggtgcagatgcctta
gaactgggctttccgttttccgatcccttggccgatggccctgtgatccaaggtgctaac
ctgcgttctttagccgctggcacgactccaacggcgtgttttgaattactggcgcaagtg
cgtgctaaatatcctgaactgccaatcggtttgctgctgtatgcgaacttagtctttgct
aatggtatcgatgcgttttacgccaaagcgcagcatgcgggtgtggattcagtgcttatt
gccgacgtaccagtggaagaatcagcgccatttagcgaagcggctaaagcccatggtatt
gcgccgatttttatcgccccgcctaatgccgacactgaaacccttgcactggttagcgcc
agcggcgaaggttacacctatctcttatcccgcgcaggggtgacaggaacagacactaaa
gctggcgttccggtggaagaaattctattcaaattgaaaacttttaacgcgccgccaccg
ctactcggctttggcattgccgaacccgctcaagtaaccgccgccataaaagcgggcgct
gcaggggcaatttctggctctgccgtcgtgaaaatcatcgaaaaccaccagcacgatgaa
gctaagctactggcgacacttggcgattttactcgcgccatgaaagcggcgacctaa

DBGET integrated database retrieval system