KEGG   Shewanella baltica OS223: Sbal223_1660Help
Entry
Sbal223_1660      CDS       T00803                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sbp  Shewanella baltica OS223
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sbal223_1660
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal223_1660
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal223_1660
Enzymes [BR:sbp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sbal223_1660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1940357..1941547)
Genome map
AA seq 396 aa AA seqDB search
MSKLKLNPYFGEYGGMYVPQILVPALKQLETAFVEAQEDDDFKAEFTDLLKNYAGRPTAL
TLTRNLSPNPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSG
SYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQMLEREGRLPDAVIACVGGGSNAIG
MFADFIDEPSVELIGVEPAGKGIDTPMHGAPLKHGKTGIFFGMKAPLMQDSEGQIEESYS
ISAGLDFPSVGPQHAHLNATGRARYESATDDEALEAFQQLARCEGIIPALESAHAIAYAV
KMARECTKETILVVNLSGRGDKDIFTVSDILNGKEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagttaaagcttaacccttatttcggcgaatacggcggcatgtatgtgccacag
attttagtgccagcccttaagcaattagaaactgcctttgtggaagcgcaggaagatgac
gactttaaagccgaatttaccgatttactaaagaactacgcgggtcgcccaacagcactg
accttaacccgcaatttaagccctaatcctatggtgaaaatctacctcaaacgagaagat
ttactccacggcggcgcccataaaactaaccaagtgttaggccaagctctgcttgctaaa
cgcatgggcaaaaaggaaattattgcagaaaccggtgctggacaacacggcgttgccacc
gcccttgcctgcgcgctattaggcttgaaatgtaaagtctatatgggcgcgaaagacgtt
gcgcgccaatcacctaacgtatttagaatgcggttgatgggcgcggaagtcattcctgtc
acctcaggttctgccaccttaaaagatgcctgtaacgaagcgatgcgcgactggtctggc
agctacgaaaaagcccactatttactcggcacagccgcggggccacatccattcccaaca
atcgtgcgtgagttccaacgcattattggcgaagaaaccaaaaagcaaatgctagaacgt
gaaggtcgcctacccgatgcggttatcgcctgtgtgggcggcggttccaacgccatcggc
atgtttgctgactttatcgacgaaccaagtgtcgaactgattggcgtcgaacctgcgggt
aaaggcatcgacacgccaatgcacggcgcgccgcttaaacacggtaagacaggtattttc
ttcggtatgaaagcgcctttgatgcaagatagcgaaggtcaaatcgaagaatcctattcg
atttcagctggattggacttcccatccgttggcccgcagcatgcgcatcttaatgccaca
ggccgcgcccgttatgaatcggctaccgacgatgaagcgttagaagccttccaacaactg
gctcgctgtgaagggattatccccgcattggaatcggcacatgctatcgcctatgccgtg
aaaatggcgcgcgagtgcaccaaagaaaccattttagtggtcaatctttccggtcgtggc
gacaaagatattttcaccgtttctgacattttgaatggtaaagaggtataa

DBGET integrated database retrieval system