KEGG   Shewanella baltica OS223: Sbal223_1678Help
Entry
Sbal223_1678      CDS       T00803                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sbp  Shewanella baltica OS223
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sbal223_1678
Enzymes [BR:sbp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sbal223_1678
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Sbal223_1678
Lipid biosynthesis proteins [BR:sbp01004]
 Fatty acid synthase
  Component type
   Sbal223_1678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1963093..1963650)
Genome map
AA seq 185 aa AA seqDB search
MATPAHAAKVLILGDSLGASYGMAEQSGWVALLQKNLPEHQFTNGSVSGETTAGGLRRLP
ALLDSVAPDLVVVELGGNDGLRGFPPTQLENNLIQIITLAKDSGAKVLLTEIMVPPNYGP
RYTQKFTQVYQDISKAQDIVLIPFFMQDIAPHPELMQRDGIHPNEKAQAQIATWMQPWIE
DALTQ
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggccacgccagcgcacgcggcaaaggtgttgatcctcggcgacagcttaggcgctagc
tatggcatggcagagcagtcaggctgggtggcgctgctgcaaaaaaatctgcccgaacat
caatttactaatggctcagtgagcggcgaaaccacagcgggaggcttacgccgattaccc
gccttactcgattccgtcgcccccgaccttgtggtcgttgaactaggtggcaatgatggt
ttacgtggattccccccaacgcaacttgaaaataatctaatccaaatcattaccctagcc
aaagatagcggcgcaaaagtgctgctgaccgagatcatggtaccgcctaactatggccct
cgctacacccaaaagttcacccaagtgtatcaagacatatccaaagcacaggatatcgtg
ttgatccccttctttatgcaggatatcgcgccccatccagaattaatgcaacgggatggc
attcaccccaacgaaaaggcgcaggcgcagatagcaacttggatgcaaccatggatagaa
gatgcgttaacccaataa

DBGET integrated database retrieval system