KEGG   Shewanella baltica OS223: Sbal223_1771Help
Entry
Sbal223_1771      CDS       T00803                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sbp  Shewanella baltica OS223
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sbal223_1771 (recR)
DNA repair and recombination proteins [BR:sbp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sbal223_1771 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2081235..2081834
Genome map
AA seq 199 aa AA seqDB search
MKFSPLLDELIQSLRCLPGVGPKSAQRMAFQLLERDRKAGLKLASALSSAMSDVGHCQSC
RTYTEETLCPICASHKRGTSSTICVVETPADVLAIEAGGHFTGRYFVLLGHLSPLDGVGP
EELGLALLERHLASGDVAELILATNPTVEGEATAHFIADMARRHKVMISRIAHGVPVGGE
LEYVDSTTLALSFNGRLPL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtccactgttagatgagttaattcagtccctgcgttgtttacctggggtt
gggcctaaatcggcgcaacgtatggcgtttcagttactcgagcgcgacagaaaagcaggg
cttaaattagccagtgcgctgtccagtgcgatgagtgacgtcggtcattgccagtcttgc
cgaacctacactgaagaaaccctctgtccgatttgtgctagccataaacgcggtacgtct
tccaccatttgtgtggtggaaacgccggccgatgtgttagccattgaggcgggtggacat
ttcaccggtcgctactttgttcttttaggtcatttatcgccactcgatggtgttgggcca
gaagagctaggtttagcgttactcgagcgccacttggcttcgggtgatgtggccgagttg
attttagcgaccaatccgacggtagaaggcgaggcaacagcgcattttattgctgatatg
gccagacgccataaggtgatgatcagtcgcatcgcccacggcgtgcccgtgggtggcgag
cttgaatatgtggatagcacgacgttagccttgtcattcaatggccgtttaccgctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system