KEGG   Shewanella baltica OS223: Sbal223_1771Help
Entry
Sbal223_1771      CDS       T00803                                 

Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
sbp  Shewanella baltica OS223
Pathway
sbp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sbal223_1771
DNA repair and recombination proteins [BR:sbp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Sbal223_1771
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sbal223_1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH Nop10p
Motif
Other DBs
NCBI-ProteinID: ACK46276
JGI: Sbal2231771
UniProt: B8E703
Position
2081235..2081834
Genome map
AA seq 199 aa AA seqDB search
MKFSPLLDELIQSLRCLPGVGPKSAQRMAFQLLERDRKAGLKLASALSSAMSDVGHCQSC
RTYTEETLCPICASHKRGTSSTICVVETPADVLAIEAGGHFTGRYFVLLGHLSPLDGVGP
EELGLALLERHLASGDVAELILATNPTVEGEATAHFIADMARRHKVMISRIAHGVPVGGE
LEYVDSTTLALSFNGRLPL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttagtccactgttagatgagttaattcagtccctgcgttgtttacctggggtt
gggcctaaatcggcgcaacgtatggcgtttcagttactcgagcgcgacagaaaagcaggg
cttaaattagccagtgcgctgtccagtgcgatgagtgacgtcggtcattgccagtcttgc
cgaacctacactgaagaaaccctctgtccgatttgtgctagccataaacgcggtacgtct
tccaccatttgtgtggtggaaacgccggccgatgtgttagccattgaggcgggtggacat
ttcaccggtcgctactttgttcttttaggtcatttatcgccactcgatggtgttgggcca
gaagagctaggtttagcgttactcgagcgccacttggcttcgggtgatgtggccgagttg
attttagcgaccaatccgacggtagaaggcgaggcaacagcgcattttattgctgatatg
gccagacgccataaggtgatgatcagtcgcatcgcccacggcgtgcccgtgggtggcgag
cttgaatatgtggatagcacgacgttagccttgtcattcaatggccgtttaccgctttaa

DBGET integrated database retrieval system