KEGG   Shewanella baltica OS223: Sbal223_1818Help
Entry
Sbal223_1818      CDS       T00803                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sbp  Shewanella baltica OS223
Brite
Enzymes [BR:sbp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Sbal223_1818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2143769..2144803)
Genome map
AA seq 344 aa AA seqDB search
MTKLTSIAIFIAGIFASAHAISAEPIEVIKAVKVTEPEKVELGKMLFFEPRLSKSGYISC
NSCHNLATGGVDALPTSVGHNWQQGPINSPTVLNANYMLAQFWDGRASDLQAQAAGPIEN
PKEMGYSHALATQTIASMPAYRAHFAKVYGDENVTIDRLTDAISTFEKTLVTPNSPFDQY
LLGKQDAISVDAKAGYQLFKSKGCVSCHNGPAVGGTMYMKMGLIKPFHTNNPAEGRIAVT
GKEADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLSDKENLEMVAFL
VSLTGDQPQITLPILPPSNKNTPRPVPFSHDPMSSKPVSSELLK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactcacatctattgctattttcattgcgggtattttcgccagtgcccatgcc
atcagtgctgaacccatcgaagtgataaaagcggtgaaagttaccgaaccggagaaagtt
gaactcggtaaaatgctgttcttcgaaccaaggctatccaaatcgggctacatctcctgt
aactcttgccacaatttagccactggcggagtcgatgccctaccaacctctgttggccat
aattggcaacaaggcccgattaactcgcccacagtgctcaatgccaattatatgctggcg
caattttgggatggccgcgccagtgatttacaagcgcaagccgctggccctatcgagaat
ccgaaggaaatgggctatagccatgcactcgcgacacaaactattgcctctatgcctgcc
tatcgggcgcattttgccaaagtctatggcgatgaaaacgtcacgattgatcgcttaacc
gatgcgatttccacctttgaaaaaaccttagtcacgccaaatagtccgttcgatcaatat
ttattgggcaagcaagatgcgatcagtgtggatgccaaagcgggttaccaactgtttaag
agcaaagggtgtgtaagctgccataacggtccagccgtcggtggcactatgtatatgaag
atggggttgattaaacctttccacaccaataatcccgccgaaggtcgtatcgcagtcaca
ggtaaagaagccgataagtttgtctttaaagtgccgacactgcgcaatattgaactcacc
tatccctacttccacgacggcagtgtctggaccttagaagaagcggtgaacactatggcc
gatattcaattaggccaaaaactgtcggacaaagaaaatctagaaatggtcgcctttctc
gtctcgttgacgggggatcaacctcagatcaccttgccgattttgccgccatccaacaag
aacacaccgcgaccagtgccttttagccatgatccaatgagtagtaagccagttagcagt
gagctattaaagtag

DBGET integrated database retrieval system