KEGG   Shewanella baltica OS223: Sbal223_1837Help
Entry
Sbal223_1837      CDS       T00803                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sbp  Shewanella baltica OS223
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal223_1837
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal223_1837
  Amino acid metabolism
   00310 Lysine degradation
    Sbal223_1837
Enzymes [BR:sbp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sbal223_1837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2169656..2170843
Genome map
AA seq 395 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FEEGATVLGEQVIAKFIAGAVSGKEVTKAQAEAATPAAETSDESSDALSPSVRRLLAEHN
VDASKVKGTGVGGRITKEDVEAFVKSAPKAAAPAPAVAPLAAGRSEKRVPMTRLRKTIAN
RLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYIKAVTEALKRFP
EVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMNLAEIEKAVRDLALKGRDGK
LTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMYL
ALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactaccagaatctgttgccgatgccacgattgcc
acttggcatgtgaaagtgggcgagcaagtttctcgtgatcaaaacctggttgatattgaa
accgataaagtggttcttgaagtggttgcgccagaagatggccacattggcgagtttttg
tttgaagaaggcgccactgttctgggtgaacaagtgatcgctaaattcatcgccggtgct
gtatctggcaaagaagtcactaaagcgcaagctgaagcggctacgcctgcagctgaaacc
agcgatgaaagcagtgatgcgttaagcccatctgtacgccgtttactggctgagcacaat
gttgatgccagcaaagtaaaaggcactggtgtgggtggtcgtattactaaagaagacgtt
gaagcttttgttaagtctgcgcctaaagcagcggcgccagcacctgctgtggctccatta
gcggctggccgtagcgagaagcgcgtgccaatgacacgtctgcgtaagacaatcgctaac
cgcttgttagaagcgaaaaactctaccgctatgctcaccacgtttaacgaagtgaacatg
aagccaatcatggatatccgtaagcaataccaagatatctttgaaaagcgtcacggtatc
cgtttaggctttatgtctttctacattaaagccgtgactgaagcgctgaaacgtttccct
gaagtgaacgcgtctattgatggcgatgatatcgtttatcacaactacttcgacatcagc
atcgcagtatcaacgccacgtggtctggtaacaccagtgttgcgtgacactgataccatg
aacttagctgaaatcgaaaaagcagttcgtgacttagcccttaaaggccgtgacggtaag
ctgactgtggctgacatgactggcggtaacttcactgtgactaacggtggtgttttcggt
tcactgatgtctacaccaattcttaacctgccacaaagcgcgattttaggcatgcatgcc
attaaagatcgcccaatggcagtcaatggtcaggttgaaatcctgcccatgatgtacctg
gcactctcatatgaccatcgtattgttgatggccgtgagtctgttggtttcttggtggcg
attaaagacttcctagaagacccaactcgtctgctgcttgatctgtaa

DBGET integrated database retrieval system