KEGG   Shewanella baltica OS223: Sbal223_1838Help
Entry
Sbal223_1838      CDS       T00803                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sbp  Shewanella baltica OS223
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal223_1838 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal223_1838 (sucC)
   00640 Propanoate metabolism
    Sbal223_1838 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Sbal223_1838 (sucC)
Enzymes [BR:sbp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sbal223_1838 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2170949..2172115
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKSLFAEYGLPVSEGFACDTAQEAVEAAGHIGGNLWVVKCQVHAGGRGKAGGV
KVTGDKEEIRAFAEHWLGKNLVTYQTDEKGQPVAKILVESCTDIANELYLGAVVDRATRR
VVFMASTEGGVEIEKVAEETPELIHTAIIDPLTGPQGYQARDLGFKLGLNPTQMKQFTKI
FMGLATMFVDHDFALLEINPLVITTEGNLHCLDGKIGIDGNALYRQPKIKGMHDPSQDDA
REAHAAKFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGTNAELGREV
LAKSGLDIIAATSLTDAAEQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaatccttatttgccgaatatggtttaccagtgtca
gaaggttttgcatgtgatacagcccaagaagctgtagaagcggcaggccatattggcgga
aatttatgggttgttaagtgtcaagtacacgcaggcggccgcggtaaagcgggtggcgtt
aaagtcactggcgataaagaagaaatcagagcctttgccgaacactggttaggcaaaaat
ctggtgacttatcaaactgatgagaaaggtcagccagttgctaaaattttagtagaaagc
tgcaccgacattgctaacgaactgtacctaggtgccgttgttgaccgcgcgactcgtcgc
gtagtgttcatggcgtcgactgaaggtggtgttgaaattgagaaagtggcagaagaaacg
ccagaactcatccacactgcaatcatcgatcctttgactggtccacaaggttatcaagca
cgtgatcttggcttcaagttaggtttaaacccaactcaaatgaagcagttcactaagatt
ttcatgggtctggcgactatgttcgttgatcatgatttcgcattgcttgaaatcaacccg
ctggttattaccactgaaggcaacctacactgcctagacggtaaaatcggtatcgacggt
aacgcactttaccgtcaaccaaaaatcaaaggcatgcacgatccatcacaggatgatgcc
cgcgaagctcacgctgctaagttcgaactgaactatgtagcattagacggtaacgttggc
tgtatggtgaacggtgctggtctggctatgggtactatggatatcgttaacttgcacggt
ggcaagccagcgaacttcctagacgtaggcggcggcgcgactaaagaacgtgtagcagaa
gctttcaaaatcattctgtctgacagcaatgtgaaagcggttctggttaacattttcggc
ggtatcgtacgttgtgacatgatcgcagaaggtattatcggcgctgttaaagaagtgggc
gttaaagtacctgttgtggttcgtttagaaggtactaacgctgaacttggccgtgaagta
ttagctaaatcaggtcttgatatcattgcagctaccagtctgactgacgcggctgagcaa
gttgttaaagctgcggagggcaaataa

DBGET integrated database retrieval system