KEGG   Shewanella baltica OS223: Sbal223_1943Help
Entry
Sbal223_1943      CDS       T00803                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sbp  Shewanella baltica OS223
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal223_1943
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Sbal223_1943
Enzymes [BR:sbp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sbal223_1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2299058..2300086
Genome map
AA seq 342 aa AA seqDB search
MSYLMLDLLSLDVSEAESEMLRHPQVGGLILFSRNFSSRDQLIRLVQQIRQIRPELLIAV
DHEGGRVQRFRDGFTVIPAMGDILPAAKGDIALAKRWACELGFLMAIELLACDIDLSFAP
VLDLNGVSQVIGKRSFSPEPAEVITLAESFIAGMAAAGMGAVGKHFPGHGSVVADSHYEK
PIDERDAEAIFVKDILPFKELIAKEKLLGVMPAHVVYPKVDPNSAGFSEYWLKQVLRKEL
GFNGVIFSDDLGMQGAGFAGDYRARASAALAAGCDMILVCNDNAGVMSLLDGFTWPASAP
QYPASLLKPNAAQTAAALDNTARWENAKQLAEQICLAQQAKV
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagctatttaatgttggacctactgtcgttggacgtcagtgaagcagaatctgagatg
ctacgccatccacaggtgggtggtttaattctattttcccgcaatttttcaagccgtgat
cagctgatccgtctggtacaacagatacgtcaaatccgccctgaactattaattgccgtc
gatcatgagggcggtcgagtacaacgcttccgcgatggctttaccgttattcccgccatg
ggcgacattttacccgcggcaaaaggtgatatagcgttagccaaacgctgggcctgtgag
ctgggtttcttgatggcgattgaactactggcctgcgatatcgacttaagtttcgcgccc
gtattggacttaaacggcgtgagccaagtgattggtaaacgcagttttagccctgagcct
gccgaggtgattacactggccgaaagctttattgccggcatggccgccgctggcatgggc
gccgtgggtaaacatttccccggacacggcagtgtagtggcggattcgcactacgagaaa
ccgattgatgagcgcgatgccgaggcgatttttgtgaaggatatcctgccgtttaaagaa
ttgatcgcaaaagaaaagttattaggcgtgatgcccgcgcacgtggtttatcctaaagtc
gacccgaattctgcgggcttctctgaatactggctaaaacaagtgctgcgcaaagaactt
ggctttaacggggtgattttctccgacgatctcggcatgcaaggcgcaggatttgcgggc
gattaccgagcaagggccagcgcggcgttagctgccggttgcgacatgattttagtgtgt
aatgacaatgcgggcgtaatgtcgctgctggatggttttacatggccagcgagtgcgccg
cagtatcctgcaagtttactcaagcccaatgccgcacaaacggccgcagcgctcgataat
accgcccgttgggaaaacgcgaaacagcttgcagagcaaatttgtttagcccaacaggcg
aaagtttga

DBGET integrated database retrieval system